SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031808 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031808
Domain Number 1 Region: 3424-3591
Classification Level Classification E-value
Superfamily SPOC domain-like 4.32e-62
Family SPOC domain 0.000000039
Further Details:      
 
Domain Number 2 Region: 437-591
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.9e-31
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 3 Region: 5-91,333-416
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.92e-21
Family Canonical RBD 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031808   Gene: ENSMODG00000003411   Transcript: ENSMODT00000033382
Sequence length 3592
Comment pep:known_by_projection chromosome:BROADO5:4:375580193:375658157:-1 gene:ENSMODG00000003411 transcript:ENSMODT00000033382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQ
KAHNSVNKMGDRDLRTDYNEPGTIPSAARGLDDTVSIASRSREVSGFRGGGGGPTYGPPP
SLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDPRERTLQH
GLYYTSSRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDEITREVRGRRPERSYQH
SRSRSPHSSQSRNQSPQRLASQASRPARSPSGSGSKSRSSSSDSLSSSSSTSSDSSDSSS
SSSDESPARSVQSTAVPAPTSQLPPSLEKEEPRKSFGIKVQNLPVRSTDTSLKDGLFHEF
KKYGKVTSVQIHGASEERYGLVFFRQQEDQEKAQNASKGKLFFGVQIEVTAWVGPETESE
NEFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIVDIDIKKVNGVPQYA
FLQYCDITSVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGLSTNITDQYLTRHFCR
YGPVVKVVYDRLKGMALVLYNEIEYAQAAVKETKGRKIGGNKIKVDFANRESQLAFYHSM
EKSGQDIRDFYEMLSERRHMKMKTGSHRDSGGEGWNSWRVTYERRGSYDYTTDRTYYESV
RTPGSYSEDPRREYPARGREFYPDWDPYQGDYYEPRYYDDPREYRDYRNDPYEQDIREYS
YRQRERERERERFESDRDRDHERRPIERSQSPAHSRRAPSPVVPSPQSERHQSDSERRVY
SRSSDRSGSCSSVSPPRYDKFEKTRIDRYTKIEKPDKERTFDPERVEKEKRPVRKEKPER
AEKEKPTFQQRRKAKIHSPGSQSSETDQENERDPSPEKWKSNSKQSKEKADKEGTAKNRL
DLMPCVVLTRVKEKEGKVIEQPYLEKLRTKLDNDSVKSPFLDQKFQLSQADAAKSGDQTK
VDIVRPKVPKEKVPVSHPEVTADKEGKLKPKKHLKDPTTESVSAVDQDKLEARKRRFADV
NLKPDRQKLEVKKSILDEDDAKAVFKRQPEPSTREVTVLKDAEPEKKPIKKDIFRREPKK
LERIKLEKLISAPSPKECQELASISVGMMAKPPLDVQPRPGDTVEESMESQEILSKKFNL
IKPQHKQPQPLDDQGTEKEEIKKNLSSIPEEMADHKTSQEKPQSADNEEKIGIDIDHTQS
YRKQMEQSRRKQQMELEIAKTEKFGSPKKEVDEYERRSLVHEVGKPPQDVTDDSPPSKKK
KVDHFDFEIGTKRERNYRSSRQISEDAERTSCSPSVRHFPFHEEDETVDSPRLIPLKETK
ESPKIDEKGLSYSNMTVREESLKFNPYDSSKKEQMADMAKIKLSGLNCEDEQNRWETQMK
VEPNRVDVSFPSSIIKRDSLRKRSIHRDLEPGEVPSDSDEDGEQKSHSPKASSLLENSRL
SFLLRDRDDKVRERDERLSGSLERNKFYSFALDKTITPDTKALLERAKSLSSSREENWSF
LDWDSRFASFRNNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGKTGDKKDDQKEEEQERQE
LFASRFLHSSIFEQDSKRLQHLERKGEELDLLSSRLYGRQTSSEGSNSTSDLIQEPVVLF
HSRFIELTRMQQKEKEKDQKSKEVEKQEDKENQPETLESVSEHKEPELKSPSVVGPAPGS
AAPQESGPLSLEKEKTVEAPLAKEERTVELVSLTGEPKCVTEHATVMMEQSEKMDLPPVS
ETNKEIVPAPLVSQENLPAEHPSYLDTKPPTPGASFSSQVDISIDPEPESTPLISPLSKP
VQKPEEPSEVKEEKPAPAAKTNCDTSQKVEVLPEVQPPGSDNDLEVEPPVVAKDKKSNKN
KRSKTPVQSTIVSVPEKPVTRKSERIDREKLKRSSSPRGETQKLIELKMEAEKISRNAAK
SPSSAVETENIEPSLPLSRTRRRNVRSVYANPGDKEEPSPVKDLVEQPRSTRKREREAQE
MGSLSTTPRRGRPPKTRRRAEEDVSPVKAEQDTEEAEPKDTVEPLKLAEGWRSPRSQKSV
APTGPQGKKGKNEQKVDVTADPPEETNEMGDQESVINDSSSKPKSDKEETGGSEQKLDKK
EVDPDKNPPETPPGEAVEKKQVPEKSSKYKRGRSRNTKSSVDKTPLCLKNVEIRLNVDEV
KGVLRPTDEEGETVATPPSKIKSPTKEDNLSPQIKNEPEDLVNESENEVVQDPKESPEAA
QLAKQIELEQAVENIAKLTETSSLATYKEPSAEVTEVHPEEEGDKPAHQASETELAAAIG
SIINDISGEPESFPAPPTYSAESEAEMATEPLVQAEMEPETDQAVSGILETDNAVEPSVP
PASDPAPSAHPGDPKDPEGNTTVSPSSAQEPEVVLQETEVSRKDRVRQKSTRSRRKRSTS
KKGDAVEANALESEQAPNKCPVTSELKLKPPETPKEDKQNKNSHPVSSEPNPTDSSKNPA
NETITIELVAEEDPPAKAPALLDLPPQAVPVDDGSQASFKVRSTSENAPITPPSVPSTPT
PTIPSAAAAKLPTPIPSGMVPHHPSTTKVTDWITRHEEARARSTPPPALPPDTKASDIGT
NSSTLRKILMEPKYVSATSITSTHVTAAIAEPVSAPRLEEVSHPPVESIKPVSEEKPAVP
IPNTSDLSAAEAPVFTEKEKVTTVIAPKATSVISRMPTKNDLEESPRMAATKQTQSVQTC
LGNALSSKYKPWPSTNENSRFHPGSMSVIEDRPSETGSSPGLRVNTSEGVVLLSYSGQKT
EGPQRISAKISQIPPASAMDIEFQQSMSKPQVKQESVMSSQPAPKLGSQTPTGYGSVPTH
SSLVLGSQPYTTSPVIASIKQERPSLEKLEPSHLSVSTPVNQAGPGKGLSQAANTPPVLV
HSQLVLSPGVASTNKKPPDPGSLKVETKVLQPSNLSPGLSSHHPPSLSGKLHSEANHVGS
GPSTPTDRAISHLGVLKQEPHSPRTSGHSPSPFPRACHPSSTSSPVLSNNASVMLAPGIP
VPQYISSMHPEQSVIMPPHSITQTVSLSHLSQGEVRMNTPPLSNIPYGIRPEGLHSPRAS
LQPQMEIRPQRSGTPQPAPIVIPPLSSQHPPEDEMHYHHPVCRGAAPGQSDVLVMQPEYR
MHPYTVPREVRLMRHPHVATVGEHHLDARQSRTPEGSVKTPPASKTPQPGKENPAPKASD
VAMAPSPHSEPRLLSVPPGGQLPGLPLTPPGGVPHSVQIIHPSGDVYHEYRYGDLRSYHT
TPQLGHPQFPGASQIGLPSRSMTPSQVRKQCPSFSLGQDSSSSPSLRPRDPLQPAVPPEG
EHSHPSQPVRSKTPQVSQDVKATQTGAPEQTQHAAGNRHSSQLDSHLHIQRAQAEAGQTS
YPSPVAVSIKTELPSPHAPQAVQKQPLLIPATSGQGASSGLPRPEPHSVLKQEFSPQPVS
QRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPTSEVGPPLRIAQR
MRLEASQLDGVARRMTVETDYCLLLALPCGRDQEDVVNQTESLKAAFITYLQTKQAAGII
NVANLGSNQPAYVLQIFPPCEFSERHLSRLAPDLLASISNISPHLMIIIASV
Download sequence
Identical sequences F6VQG1
ENSMODP00000031808 ENSMODP00000031808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]