SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031852 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031852
Domain Number 1 Region: 254-469
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-53
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 762-901,947-1092,1135-1151
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000179
Family WD40-repeat 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031852
Domain Number - Region: 482-536,649-706
Classification Level Classification E-value
Superfamily PH domain-like 0.000671
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031852   Gene: ENSMODG00000002635   Transcript: ENSMODT00000033426
Sequence length 1215
Comment pep:known_by_projection chromosome:BROADO5:4:373692895:373928647:-1 gene:ENSMODG00000002635 transcript:ENSMODT00000033426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDPSPQPAVGDQLAQDVPGTSPEAEEDPGEAFEFDDSDEEEENPKTGPEKDGEPPLI
CFDAAPITDPAAAQPQTEIPAVVSNGEPMGAGVRRSSWKRKSSRRVDRFTFPILEEDVIY
DDVPCENLDSHQHGSERSLIYENVHREGGPRESEDLGWSSSEFESYSEDSGEEEVKPEVE
PTKHRVSFQPKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKEVLGDSEEEDMGFLEV
TVSDIKHPAPELGPMPDGLSPQQVVRRHILRSIVQSEGSYVESLKRIIQDYRNPLMEMEP
KVLSVRKCQVVFFRLKEILQCHSMFQIALSSRVAEWDTTEKIGDLFVASFSKSMVLDVYS
DYVNNFTTAMSIIKKACLTKPAFLEFLKRRQVSSSDRVTLYGLMVKPIQRFPQFILLLQD
MLKNTSKGHPDRLSLQLALTELETLAEKLNEQKRLADQMAEIQQLTKSVSDRSSLNKLLT
SGQRQLLLCETLTETVYGDRGQLIKSKERKVFLLNDMLVCANINFKAETGREASDPVPLG
PPFRGKDSLAIGSMEWNVLGFLFVLHSSKKKLLRLCVFSFPDKVYLGPPRLFQELQDLQK
DLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGK
PDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLSPDDDKKNKAPFWCP
ILACCIPAFSSRTLSLQLRSLIHSPVQSPLLGFSAVSTSLPQGYLWVAGGQDGVGGQVEI
FSLNRPTPRMVKSFPVASPVLCMEYIPEKNEEDEEQESGRVATDSSSAVHPTICLGLQDG
SILVYGSVDTGTQCLVTCKSPGLQPVLCLCYSPHYLFAGLQDGTVAAYPQSKGNLAWVPT
PPLISMCPGRMCPVSQLLPLFQMTGHLWLLESGSPNSVISHFPCLLQQSFEAHQDEAASV
THMVKAGSGVWMAFSLGASIRLFHTETLEHLQEINIATRTTFLMPGQKHVCVTSLLICQG
QLWVGTDQGIIVLLPVPRLEGIPKITGKGMVSLNGHCGPVDFLAVATSTLAPDILRSDQD
EAEEEKSDGPAHEPPPAPDSHPTRELIHKKGILLQYRLRSTAHLPGPLLSVRDPPDPDGT
ALAHSEEDGSIYEMADDPDVWVRSRPCARDAHRKEISSVAIISGGQGYRNFGGGGPALGS
ETDSTLLIWQVPLTI
Download sequence
Identical sequences F6U971
ENSMODP00000031852 ENSMODP00000031852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]