SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032034 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032034
Domain Number 1 Region: 381-547,843-1061,1107-1144
Classification Level Classification E-value
Superfamily Ras GEF 1.05e-107
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 528-616
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-20
Family PDZ domain 0.004
Further Details:      
 
Domain Number 3 Region: 259-383
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-17
Family cAMP-binding domain 0.0012
Further Details:      
 
Domain Number 4 Region: 17-117
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000537
Family cAMP-binding domain 0.0065
Further Details:      
 
Domain Number 5 Region: 753-832
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000207
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032034   Gene: ENSMODG00000014131   Transcript: ENSMODT00000033608
Sequence length 1646
Comment pep:novel chromosome:BROADO5:1:305143257:305429333:-1 gene:ENSMODG00000014131 transcript:ENSMODT00000033608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPVDPSAKQALRKKPPERTPEDLNTIYSCLHGMEILSNLREHQLRLISARARYERYNG
NQILFCSETIARCWYILLSGSVYMKDSIIFAPQSFGKQFGGKRGCECLVLEPSEMIVVEN
SKDNEEDLLQREIAGRQSRRRFRKINHRGERQTITDNVDANTYFTLPADLNKLHLTENTH
PQVTHVPSSQSGCSIASDSGSSSLSDIYQATESEIGDVDLTGLPEAPVDSEDEEEEDEDI
DRTADPLLGRDLVRECLEKEPADKTDDDIEQLLEIMHQLPAFANMTMSVRRELCSVMIFE
VVDQAGAVILADGQELDSWYVILNGTVEISYPDGKNESLCMGNSFGIIPTLDKQYMNGVV
RTKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVQEHRELDRSGTRKGHIVIKA
TPERLIMHLIEEHSVVDPTYIEDFLLTYRTFLESPLEVGNKLLEWFKLDSLRDKVTRVVL
LWVNNHFNDFEGDPAMTGFLEEFEKNLEDTKMKGHLRLLNIACAAKAKWRQILLQKTSRE
SPLFFSLSGGSEGFGIFVEGVEPGSKAAEAGLKRGDQIMEVNGQNFENITLGKALEILKN
NTHLSLTIKTNIFVFKELISRTKQEKNGVPHIPKIAEKKSNRYSIPDMPGDMEQIFPQEK
GNKKIKANTVSGGRNKIRKILDKTRFSILPPKLFSDGSVSQSQDDSVLGTRQCRHSLAIM
PIPGTLSSSSPDLLQPTTSMLDFSNPTDIPDQVIRVFKADQQSCYIIISKDTTAKEVVSH
AVHEFSLTGAPETYSLCEVSVSPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETL
CSDEDAQELLRESQITLLQLSTIEVATQLSMRDFELFRNIEPTEYIDDLFKLNSKTGNTH
LKEFEDIINQETFWVASEILTESNQLKRMKIIKHFIKIALHCRECKNFNSMFAVISGLNL
APVARLRGTWEKLPSKYEKHLRDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKD
ITFLHEGNDSKVDGLVNFEKLRMIAKEIRQVVRMTSANMDPAVMFRQRSLSQGSTNSNML
DVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLANLNVETDEEKFQIMSLQWEPAYS
TLNKNLSERRSTKSSEMSPVPLRSVGQITKAHLHQPNRMSQVLQVPAVNLYPIRKKGPTK
DHIAFGPSASQKIVGMSEEVSGKKPAEDTLSMASSLHSSPPASPQGSPRKVGNIRSDHGS
HLHLYGPSSSPTSDTSTKTSGIRSYGIGYAHIPSAKSENFSDSSHSEISSRSSIVSNCSV
DSMSAALQEDRCLPQSLSGVDSVGTAEKKENPPVTTDHIQHVAGWTLPKPSLVKGLAVPS
SVSTEEISHDHITIEAVDSGRGSWTSCSSSSHDNFQNIQNQKSWDLLNSYRHTHLDVPIA
EVEPTNCEPYLYAEGYTLTNCQPKDGTEWVQSRQSWASSSSLSDTYETNYGTVKRRVVED
STVEPDETLDSHASTDTTYKTVTSSTEKGLIVYCVTSPKKDDRYREPPPTPPGYMGISLA
DIKEGPPHHPHLKPPDYSVAVQRSKMVHSNLSRLSSASLGSEPMACISSKIPSQPQWHIL
QPSHPKLAGVTDADSEADENEQVSAV
Download sequence
Identical sequences F7GIM3
XP_007473468.1.35504 ENSMODP00000032034 ENSMODP00000032034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]