SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032086 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032086
Domain Number 1 Region: 1128-1197
Classification Level Classification E-value
Superfamily UBA-like 1.21e-16
Family UBA domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 1692-1790
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000106
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032086   Gene: ENSMODG00000001785   Transcript: ENSMODT00000033662
Sequence length 1896
Comment pep:known_by_projection chromosome:BROADO5:2:239902177:240167191:-1 gene:ENSMODG00000001785 transcript:ENSMODT00000033662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKKKKKQEEKKKKESAQKKAADQKTKVPEPTKTSSSQPQSAGISTSTSTSTITNSSNG
KRASANGHQPAASRYLPREVPPRFRQQEQKQLLKRGQPLPPGTLTSVSPTQGTGQAGASP
PPLTGVSGQHHPSKLQSDPSHSGLVDHYENSNWAQQPTFRSEATCTWDKVIIDRTDKEAW
PSITVTETESASECTTDIDSVSNCGPENSSMATGSAHGNFTGHTKKNNGNNGANGALVQS
TSNQSALGAGGANGNGNSSRVWGVTTGSNSNLTHCSISGGDGKMDNMIGDSRSQTCWGSS
NSNAGINLNPNANPAAWPVLGHEGTVATGNPSSICSPVSAIGQNMGNQNGNPTGTLGAWG
NLLPQESTEPQTSTSQNVSFSIQPQNLNTDGPNNTNPMNSSPNNINAMQTNGLPNWGMAV
GIGAIIPPHLQGLPGANGSSVSQVSGGNGEGINSSVWGMSPGNPATGNNNSGFSQGNGDT
VNSALSAKQNGSSRVDPTVQKEGNGANAWDSGPPASPGVLSWGRSNGSNGAGNIHSGAWG
HPSRSTSSGVNGEWGKPPNQHSNNDINGKGTMGWDNPNVTNQNPAMQQGNEQLNSWAKAA
TSGTAASEGSNDSSGSQNEGSTGREGAGESRRRDKGIIDQGHVQLPRNDLDPRVLSNTGW
GQTPVKQNTAWEFEESPRSERKNDNGTEAWGCATTQPSNSGGKNDGSIMNSTNTSSVSGW
VNSPSAANTGWGDNNKAPNGLGGWGDSISSTAVSNAAAKSGHAWNGTVNQGDKSPTWGEP
QKPKSQNWGDGQKSNPGWTSGGGDWTDSPSVLGNLSDGKKNGSGWDADNNRSGSGWNDTR
SGTSGWGSGTNAKVNPGTNWGESLKPGPQQNWSNKPQDNNVSNWGGAASVKQTGSGWVGG
PIPAKQKDISEATGWEEPSPPSIRRKMEIDDGTSAWGDPSNYNNKTVNMWDRNNPVIQSS
TTTNTTTTTTTTTNNNTNMVENLSHQSSTQLNRSSLLGPVSTGWGDMPNVHSKTEASWGE
SSSPAATVDNGTAAWGKPPSSGAGWGDNSEPSGTFGRTSAPAAAPALCKQASKSMQEGWG
SGGDEMNLTTNQWEDEEGDMWNNAASQESNSSCSSWGNAPKKGLQKGMKTSSKQDDAWIM
NRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKKVEMDKRGMGVTDYNGMVTKPL
GCRPPISKESSMDRPTFLDKLTLSFSNQDGGLVEEPTTSPFLPSPSLKLPLSNSALPNQA
LGGIASGLGMQNLNTSRQIPSGNLGMFGNSGAAQARTMQQPQQPPVQPLNSSQPSLRAQV
PQFLSPQVQAQLLQFAAKNIGLNPALLTSPINPQHMTMLNQLYQLQLAYQRLQIQQQMLQ
AQRNVSGPMRQQEQQVARTINNMQQQIQQHQRQLAQALLMKQQQPPPPHLSLHPSAGKST
MESFSSHPQGPSLPDLQTKEQQSSMNTFAPYPSLGLNPNMNVNSMDITGGLSVKDTSQSQ
SRLPQWTHPNSMDNLSSAASPLDPNPSKHGAIPGGLSIGPPGKSSLDDSYGRYDLIQNNE
SPASPPVAVPHSWSRAKSDNDKISNGSSINWPPEFHPGVPWKGLQNIDPENDPDVTPGSV
PTGPTINTTIQDVNRYLLKSGGKLSDIKSTWSSGPVSHTQASLSHELWKVPRNTTAPTRP
PPGLTNTKPSSTWGTSPLGWTSSYSSGSAWSTDSSGRTSSWLVLRNLTPQIDGSTLRTLC
LQHGPLITFHLNLTQGNAVVRYSSKEEAAKAQKSLHMCVLGNTTILAEFAGEEEVNRFLA
QGQPLPPTSSWQSNTGTNQTRMGSTNSSHGLVRNDAGHWNTPCLGSKGSTDLLWGGVPQY
SSSLWGPPSTDDGRVIGSPTPLNTLLPGDLLSGESI
Download sequence
Identical sequences F7FMK0
ENSMODP00000032086 13616.ENSMODP00000032086 ENSMODP00000032086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]