SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032264 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032264
Domain Number 1 Region: 1017-1171
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.71e-25
Family DnaQ-like 3'-5' exonuclease 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032264   Gene: ENSMODG00000004395   Transcript: ENSMODT00000033843
Sequence length 1178
Comment pep:known_by_projection chromosome:BROADO5:3:453506881:453560232:-1 gene:ENSMODG00000004395 transcript:ENSMODT00000033843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGYDPYNPDLPKPSVGTEHGSLGDVPEPSSGILELELVNQAIEAVRNEVEREEKKYKELL
ETTKEYGTTETSLVSQSPTGAGVPNPDSFATSLEYNPGSYNLLNNNTDYNPTPLAAANKC
NKYTLDSLEKSKAKGNSLEYVPKSVIQPKKYSRAIPNSKYVIDNSKPSTDLEYDPLSNYS
ARLLNKGSPKDQRGIKRRRDSHQDDSYTPSLKKHCDVFSNYETDARFSDSEDEEPSSENQ
PSPASPTKARTNSESQFSSGSSPAKGKPPEPEESSLRETKEIAVQYDMGDIQRRQSPIGK
SQPEKGKEKEAGGDPKHKGNPKEPRAQKRKLHDQKSSAEKDKGKNKDKAKGKLGEKNHRE
KKLTKVKSDVHMSKVEKSKLEKQEVARKEKLPSAMLVASSGKRKSDGLSKRPSTGKLGNH
KKESKLKPIDPPNGKNMSSSNKLKDKKGSKTFSSSKLRDKKSSSLDEGRSQGSPKPKKRT
LSHIDLFGDESGDEGEGTCPVLPATLPSLSSDSDSEDGSHSPLNESKGPKHLRGAQLSTS
SSSSSVASDDIDYSVLEKELDYDSDPMEECLRIFNESTDVKTEDKGRLNKQPSKEEKIEG
KSEDSLTTLFPGQKRRISHLSKQGNAEVPSKPVIRPYRPPTAQEACYRRTQLAQRQASDI
LASRLASQKHSMSLPEEKRRIAHIPNPRMATALAAAANSTPTGAKKSNSLNTVQVANGSE
PNISLKSRTMSGMASKTSTTSLQKRIAHMPSLQSVSLNRPVIPTEFGAKVPTNIRQRYLN
LFIDECLKFCPSPQEAYDKALSEEKVAYERSSSKNIYLNVAVNTLKKLRSLGPGSVQCVN
KNSNRKVVSHEAVLGGKLATKTSFTLNRSGNLRAEDLTGAALYRRLKDYILTEDQLKENG
YPLPHPEKPGRAVVFTTEEKKTTDSSCRICCRCGTEYLVSPTGNCIRKEECCHHWGRLRR
QRVAGGWETQYSCCSGAVGSAGCQVAKQHVQDGRKDNLEGFVKTFEKLPSTDGYPGIYAL
DCEMCYTKQGLELTRITVINSDLKVVYDTFVKPDNKVVDYNTRFSGVTEEDLQNACITLR
DVQAVLLNMFSSDTILIGHSLESDLFALKLIHTTVVDTSVVFPHRLGLPYKRALRTLMAD
YLKRIIQDNVEGHDSSEDASSCMELMIWKIKEDSKVKR
Download sequence
Identical sequences F7FLP1
ENSMODP00000032264 ENSMODP00000032264 13616.ENSMODP00000032264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]