SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032274 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032274
Domain Number 1 Region: 475-541,581-678
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-28
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 2 Region: 687-813
Classification Level Classification E-value
Superfamily PH domain-like 7.56e-20
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 1100-1232
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-17
Family Second domain of FERM 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032274
Domain Number - Region: 1001-1078
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00103
Family Ubiquitin-related 0.048
Further Details:      
 
Domain Number - Region: 18-124,586-606
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00262
Family BAR domain 0.074
Further Details:      
 
Domain Number - Region: 1236-1297
Classification Level Classification E-value
Superfamily PH domain-like 0.0262
Family Phosphotyrosine-binding domain (PTB) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032274   Gene: ENSMODG00000009952   Transcript: ENSMODT00000033853
Sequence length 1368
Comment pep:known_by_projection chromosome:BROADO5:1:271827979:271906755:1 gene:ENSMODG00000009952 transcript:ENSMODT00000033853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEIEVENGTCVNWQKRCLALETQLFRFRLQASKIRKLLADKMQELEQRLLEAEHRAEDA
ETQVGAMEEKIRLVSVKSMEPEGNLHQKYQELLETIRGKEEIISQLQVQVEKQKLLRVQD
AKTVQEKAAKIKEWVTMKLGELEMENRHLKNYNQHLLGQVRALQEALGDLSMVLPGELLW
SFQGKSKNSVVSEISTYHESRRGAVEGRPSGDNASQAHSTLRATISFPSPGTQQDKDLTP
KVGNTLKGSGIVLCREISEAKAPQLSPMGTLKLQKSPYLGEVLGGFQRGVPIKLRFPGKE
GVLGSSMTLPKSRAFRNPRDSIQLAKRRYSQPHLRTGHFNHMVSIKISALQASQDHSLPM
KETDIDQKKRKESEKMDTEEPTLDKIEVKGIELISRLNEENLERPSAGEVEMGKKPPTPP
LHRFPSWESRIYAVASSGMQLSEVSPENDASSCAASSTSLTSPGSFYRLIYKNFHVPVYT
TLKGRATQISTMPFLDESSGSEDDCSSQASFQTSFTCMESRKTSVPGSPRAIKRGVSISS
LSSESDYAIPPDAYSLDSDYSEPEYKVQRTSIYSIDELGSLGESLEKSGYLLKMDSRVKT
WKRRWFVLRHRQIMYYKSPSDVIRKPQGQVELNSHCHIVRREGAQTFQLISEKKTYYLTA
DSPNLLEEWIRVLQSLLKEQTIGSPALPQSGAKPTVRGWLTKVKHGHSKLVWCSLIGKTF
YYYRSHEDKYPLGCLPVRGARIEEVDRSCDSDEDYEAAGGMRRLLSSHSTLVIHPPEHSP
TYLLIGSKHEKDTWLYHLTVAAGSSSAKVGTAYEQLIGKLMDGEGDPGSPLWRHPMLCYS
KDGLCASLTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPEL
QSELYCQLIKQTSCHPPQKHSLLQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSET
GQYATYCQRAVKRTLKAGEREAKPSRMEVVSILLRNPYHHSLPFSIPVHFVNGTYQVVGF
DGSSTVDEFLHRLNQETGMRKTSYSGFSLFTDDPSGKDLEHCLQGRVKICDAISKWEQSL
RELHPGKSEGSNRIVKLIYKNRLYFRHQVKGETEQERLLLAFQVSNEITAGRFPVNKELA
LEMAALMAQVEYGDLEKPNLPGPGGTAPAKAQHLLQLVLDRFYPRRYRYGAPSEQLRHLA
DTLASKWTTLQGCSSSECIRTYLTVARKWSLFGAKLFAAQTTQLSTKGNTLVWIAVNEDG
ISILDHNTMRIQATHPYSLVMTFGGYQDDFMIVIRTVLDKSSGKGKIEKLIFQMALPKIA
EVTFMMASYMNHCSTVSPSSTNTLYPQEVDEKQFLASASHSSKGPTLI
Download sequence
Identical sequences F7FLH1
XP_001378386.1.35504 XP_007473139.1.35504 ENSMODP00000032274 ENSMODP00000032274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]