SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032397 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032397
Domain Number 1 Region: 215-278
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000236
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 618-730
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000249
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032397
Domain Number - Region: 731-815
Classification Level Classification E-value
Superfamily PH domain-like 0.00676
Family Third domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032397   Gene: ENSMODG00000007488   Transcript: ENSMODT00000033979
Sequence length 823
Comment pep:novel chromosome:BROADO5:2:213444668:213460118:-1 gene:ENSMODG00000007488 transcript:ENSMODT00000033979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPSAGPVPSMGDEYISTQLLPPSSSVSFSYASASWRLFLRKEVFYPRENFSHPYCLQLL
CEQILRDTFTESCTQISPEERSKMKDMLVDLKVGMDASSITEDSIKKRIVVAARDNWANY
FSRIFRVSGESGSDVQLLAVSHRGLRLLKVVNDATVHTGHLKTLCSYSFAEVLDVKAQEH
GVLQLSLRNEQLILHTSQAQAIKSMVELFLNELKKDSSYVIALRSYVTDNPSLLSFHYGD
IIKLLPMSSLEPGWQFGSIGGRSGLFPSDMVKVAAASDYLTMPMERKVEGHRNSRRESGL
SPQKQAMECEHPPSQAPSEYSGLTSSVFLDVDSTLAASISTYTMWEYALHHFRPIQTSEG
WMLDMAEHSARSLVQHTKIPIQKSLTNLTDEDMNNLAVANFMAVMQFMGDQPKKKDELDI
PYEMMKLCRDNNLKDEIYCQIIKQVTENPNQEHCIRGWYLLSLLTGYFLPSPTLMPYVIK
FLKDATLYQELAQKCQGHLQQTVKYGGRRHLPTIGEMQAFLKGQTVRSLLLHLPGGIEYK
TIIQTFTVTAEVLEEMCSQMGIREPLEVQEFAIFLIKKEETIAWDQLGVLVRPLHPNEYL
NNVTREPNVELHSRRITWDTPLHYENEIYLSTHYSQLHRDYLQGKLLVSTHSQVEALLAP
LTALQHLTRKTSDLPSEQDLLRYVPHPLQQQVNLRVLRNLMENQLKSLKRYSCREAQVNF
IEMVKSLPLFGYTIYTVLRLSEPEIATPCLLGLNRQHLILVDPRTQEQCYSIALKDIQHL
RQLSPLDGAPAMELNYGSFANPKTIWFESPQAQELRYTLIFLM
Download sequence
Identical sequences F6ZFP5
ENSMODP00000032397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]