SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032411 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032411
Domain Number 1 Region: 56-124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.85e-22
Family Canonical RBD 0.0000926
Further Details:      
 
Domain Number 2 Region: 132-249
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.78e-20
Family Canonical RBD 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032411   Gene: ENSMODG00000015125   Transcript: ENSMODT00000033993
Sequence length 447
Comment pep:known_by_projection chromosome:BROADO5:8:289660339:290411085:1 gene:ENSMODG00000015125 transcript:ENSMODT00000033993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRLEQPQMYPQYTYCYPHYLQTKISPRALFISPHTTSTPLPLSSLPTGINMTSCGEQL
SKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKA
VASLKANGVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGV
SRGVGFARMESTEKCEVVIQHFNGKYLKTPPGVPAPTEPLLCKFADGGQKKRQNQSKYTQ
NGRPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQ
STSWMPHPPYVMQPTGAVITPTMDHTMSMQPASMMGPLTQQMNHLSLGTTGTVSICVCVC
VMCSLLCIQNTHLHLPYMTAAAPMQGTYIPQYTPVPPTAVPIEGVVADTSPQTVAPSSQE
ASAQQQQIAVETSNEHTPAYSYQQSKQ
Download sequence
Identical sequences F7F714
ENSMODP00000032411 ENSMODP00000032411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]