SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032532 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032532
Domain Number 1 Region: 9-121
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-18
Family SH2 domain 0.00081
Further Details:      
 
Domain Number 2 Region: 354-520
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-16
Family Ras GEF 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032532   Gene: ENSMODG00000002291   Transcript: ENSMODT00000034116
Sequence length 648
Comment pep:known_by_projection chromosome:BROADO5:3:444968173:444978169:-1 gene:ENSMODG00000002291 transcript:ENSMODT00000034116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVGESLDPDKELVDQTWYHGRLSQKEAEALLLKDGDFLVWASPSTLVLDSSPLVLSCC
WGGQPLHFDVVRIQLRPRPGRPSRALFQLEDERFPSLPALVKCYVATQRPLSQASGAVAS
RPVARHGPPRPTTFGKPRHRRSLSGDGCSDGTRQVHKGLLRTKELSGSQPSLDTLRHRGG
PPKGSKGPGSPDDPHMAKMVPPASPLFRTGSDPVLRRAQELSIGTPQWGSDGQLHPKGPL
KPPRAPSVLLPECPGTPTSCELLPQEILHFQRKGGDDGKPGTREAARHGPRDRQETEHKT
EAWPGEETMPREGQNGQLSNKEGPQEAPWWEEWEQEEAEDFVRPQGGATPALQPQAFSSC
LLGPENRPLEPSALRTLRALFLQHDVGTVAQHLLLTDCQAAQVLGVTRTQRQAMGVHSGL
ELLTLPHGHQLRLNLLERHEALALAAATAVVGCSGPVAERVATLLGLIQLALALRAPGGA
DLFALSSVMTALQLPQITRLERTWRLLRQNHTEAALAFEKELKPFVRALDEGAEIGLPGE
VAVPHIMPVTQLLEGAQLWGSHEESCERLLRTLQGARTMASHASHYREAARARLKGFQPT
PELCEAFQTEFALRLLWGSRGAGATQAERHKKFHLILNALSWRLEPES
Download sequence
Identical sequences F6ZEF4
ENSMODP00000032532 XP_007489100.1.35504 ENSMODP00000032532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]