SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032606 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032606
Domain Number 1 Region: 189-452
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-41
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 1044-1101
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.6e-21
Family Tudor domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1102-1157
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000702
Family Tudor domain 0.00027
Further Details:      
 
Domain Number 4 Region: 877-916
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000221
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032606
Domain Number - Region: 970-1012
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00233
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032606   Gene: ENSMODG00000001130   Transcript: ENSMODT00000034188
Sequence length 1225
Comment pep:known_by_projection chromosome:BROADO5:3:441844492:442148955:1 gene:ENSMODG00000001130 transcript:ENSMODT00000034188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCGLPGGPANPCPKSLLTHLFAGQGAGPCLVDRRSGGGGAELSAVANGRAGVGAGANG
GRGGAGPSRIELLLRRGRVLAERASKGARSQRRSQRLLAQPPRDGVTELTRRAVAIRFGT
EPLGIMGSENPSPQNPSCKIMTFRPTVEEFQDFGKYVAYIESQGAHRAGLAKVIPPKEWK
PRKTYDDIDDMVIPAPIQQVVTGQSGLFTQYNIQKKPMTVGDYRRLANSEKYCTPRHQDF
EDLERKYWKNLTFVSPIYGADISGSLYDADVEEWNIGNLNTLLDMVEHECGIIIEGVNTP
YLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAKGFFPGSSQGC
DAFLRHKMTLISPSILKKYSIPFDRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATL
RWIDYGKMATQCTCRKDMVKISMDVFVRVLQPERYELWKQGKDITALDHMKPTALTSPEL
MAWNETKAVLKAKLLRRSHRKKSQPRRHKTEDQKSLGEVMAAETLLEESKVKEEPKHGPD
LEEEEQHKAPEGGEVEGRIQEERGRNIREGKCKRIYQIKSRLLGLIPPQLLSPPPQICTD
EDVPPPLPPILEPPILAPVSTATEEIFPLAAPLNIVHPSEVPSEEDDFKPRPIIPMLYVV
PRTNKVVFDKERVSCQQTLEHFAQKGQIWREQTVPMELTVKEEERIETEQVEVNPKASEV
QAPSTFSKLKMEIKKSRRHPLGKPPTRSPLSVVKQEGSSDEEAFPFSGEEDVSDPEALKS
LLSLQWKNKVHNFQAERKFNAAAALVEPYCAVCTLFYPYNQALQTDKETSPASLGETSSL
LPLSKCGQKTKPLIPEMCFTSSGENIEPLPANSYIGDDGTSLLIACAKCYLQVHASCYGI
RPDLVNEGWTCSRCTANAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEVRFLNVIE
RHPVDISAIPEQRWKLKCVYCRKRMKKISGACIQCSYEHCSTSFHVTCAHAAGVLMEPDD
WPYVVSITCFKHKAGSQGVQFLREVSLGQTVITKNRNGLYYRCKVIGTTTQTFYEVNFDD
GSYSDNLYPESIISRDCIQLGPPPEGEFVQLRWTDGNIYKAKFISAVISHIYQVEFEDGS
QLMVKRGDIYTLEEELPKRVKSRLSVSTGAPQEKVSLGEEVKAAKRPRVGNARNSEDYGQ
NPDYLAFMENLLQSQYQPGAQSHMF
Download sequence
Identical sequences F7EPQ5
ENSMODP00000032606 ENSMODP00000032606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]