SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032675 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032675
Domain Number 1 Region: 224-350
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-30
Family SH2 domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032675   Gene: ENSMODG00000000858   Transcript: ENSMODT00000034254
Sequence length 353
Comment pep:known_by_projection chromosome:BROADO5:3:440786333:440796980:1 gene:ENSMODG00000000858 transcript:ENSMODT00000034254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPKPDYTESDIFRAYRVQKSLDFEDPYEDGDGQEEPESTCP
SCPNKPSCPGDPSYSSPKHRLIKVESGDLNRSKMLLGAPGEDKVNDSEYSDPFDAQPDAH
PWDSMSPFSKKNVLLNMEGSNLQLYDTPYEEQEVGGSPEAEERPRQSRLPRDDERPAEEY
DQPWEWKKDHISRAFAVQFETPEWERAPGLAKEFRRPPAKTSGWVGKGPDPEEHIPQPAE
RVDPALPLEKQPWFHGSLSRAEAENLLALCREGSYLVRQSETSHPDFSLSLRSSQGYMHM
KFTRTKENKFVLGQHSGVFSSVPEVVHHYSIRPLPVQGTEHLALLHPITAQVP
Download sequence
Identical sequences F7D345
13616.ENSMODP00000032675 ENSMODP00000032675 ENSMODP00000032675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]