SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032687 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000032687
Domain Number - Region: 112-251
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00044
Family Hermes transposase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032687   Gene: ENSMODG00000024037   Transcript: ENSMODT00000034266
Sequence length 261
Comment pep:novel chromosome:BROADO5:1:235640719:235641609:1 gene:ENSMODG00000024037 transcript:ENSMODT00000034266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKNGRSFCILCTEMVVSRMWNINRHFETNHYQLLKKSSTNLTSATQHGKALSKGEFIKET
FIRCAPVLFHNIQNKDSIIKRISELPLSRNIIRDQVMRLNTNVQYQLKRDISNCKYFSIS
LDETTDVTSPVQLAIIGRYSDGLTMREELMKLVSMPTSTSGSETYKVVIQTFLDLSIDIS
KVVSVMTDGTPNMLGKKVRLVKLFMEVIGHPIVPFHCIIHQEALCAKAGFTNLNDLMSVV
TKIVNLIAAHSLPHKQEFSAL
Download sequence
Identical sequences F7D2S4
ENSMODP00000032687 ENSMODP00000032687 13616.ENSMODP00000032687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]