SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032732 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032732
Domain Number 1 Region: 874-1174
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.96e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000835
Further Details:      
 
Domain Number 2 Region: 215-363
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-32
Family Third domain of FERM 0.0021
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-30
Family Second domain of FERM 0.00033
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-18
Family First domain of FERM 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032732   Gene: ENSMODG00000003334   Transcript: ENSMODT00000034312
Sequence length 1179
Comment pep:novel chromosome:BROADO5:1:227773478:227882330:1 gene:ENSMODG00000003334 transcript:ENSMODT00000034312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLDNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLDKPLKKQLDKYALEPTVYFGVVYYVPTVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQRFALFPVGWLQDEKV
LEEATQKVALLHQKYRGLTPPDAEMLYMQEVERMDGYGEESYPAKDSQGSDICIGACLDG
IFVKHKNGRPPQFLSILYLWHDIANMSHNKSFFALELTNKEETIQFQTEDMETAKYVWRL
CVARHKFYRLNKCNLQTQTLAVNPVRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYS
SSQDNLFGNNQNGYYCHSQTSLDRALDYNGRIRNGSVYSAHSTNSLNNPQPFLQPSPMSS
NPSITGSDVMRPDYVPTHRHSALIPPSYRPTPDYETVMRQLNRGVSHADRQSHSLRNLNI
GNSYAYSRPDALVYSQPEIRDRAQFTSPQSAHYPFNLNYSFHSQSPYPYPAERRPVVGAV
SVPELTNVQLQAQDYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITR
RVHHSVQTFQEDSLPVAHSLQEVSEPLTSARHAQLKKRNSIEIAGLTHSFEGIRLKERTM
SASAADVALPRVIAASSQPNVFIERTKQEENEEQENVRYGHKKSLSDATMLIHSKSKART
VLSPHPDETTQLSSGIGGFSKEPLLGYPYGSLTPGPNPLHILEPKSHMLETEKSVRAISP
VHLIVEAQVPRREGLLTPSMSESDLTTSGRYRGKRDSLKKRPVLDILSGKKNVVEGLPPL
GGMKKNRADAKKCGPLKLAALNGLSLSRMPLPDEGKEVPTRATNDERCKILEQRLEQGMV
FTEYERILKKRRIDGECAIARLPDNAERNRFQDVLPYDDTRVELVPTKENNTGYINASHI
KVSVGGIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMATAEEEGGREKSFRYWPRLGS
RHNTVTYGRFKITTRFRTDSGCYATTGLKIKHLLTGQERTIWHLQYTDWPEHGCPEDLKG
FLSYLEEIQSVRRHTNSTTEPKSPNPPLLVHCSAGVGRSGVVILSEIMIACLEHNEVMLD
IPRVLEMLRHQRMMMVQTLCQYTFVYRVLIQFLRNSRLI
Download sequence
Identical sequences F7GH29
ENSMODP00000032732 ENSMODP00000032732 13616.ENSMODP00000032732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]