SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033063 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000033063
Domain Number - Region: 106-208
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0047
Family Hermes transposase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033063   Gene: ENSMODG00000024104   Transcript: ENSMODT00000034641
Sequence length 231
Comment pep:novel chromosome:BROADO5:8:255330817:255331512:-1 gene:ENSMODG00000024104 transcript:ENSMODT00000034641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDAEWKWHLAFLTDVTELLNSFNVQLQGKGKLICDMQSHVKAFEVKLGLLIKQVKEENF
CHLPLTQNLLVEKPLIAFPKEICVDSLEKLQKEFQFRFKEFHLHEQDIQLFCNPFSIDIE
NVDTIYQMELAQLQNCDSLKDTFKSSSLPNFYASLPYETYPNLRNRALKMATIFGSTSVC
EQIFSRMKYPKSLTRSRLNDAHLHHLLQLAVTNMEPDIDQLSSQKQAHSSH
Download sequence
Identical sequences F6X1Q8
ENSMODP00000033063 13616.ENSMODP00000033063 ENSMODP00000033063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]