SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033409 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033409
Domain Number 1 Region: 83-182
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000524
Family Canonical RBD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033409   Gene: ENSMODG00000020364   Transcript: ENSMODT00000034985
Sequence length 486
Comment pep:known_by_projection chromosome:BROADO5:5:299463426:299478279:-1 gene:ENSMODG00000020364 transcript:ENSMODT00000034985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGVDLIDIYADEEFNQDPEFSNADQIDLYDDVLAASSQPSDDRSSSAEPPPPIRQEQS
PKPNSKSPAILYTYSGLRNKRAAVYVGSFSWWTTDQQLIQIIRSVGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKILNGEKVDVRLATRQNLSQFEAQARKRECVRV
PRGGVPPRAHSRDSSDSADGRATPTENLVPPPPRVDKPPSVLPYFSRPPSALPLMGLPPP
PIPPPPPLSSGFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
AAVGPPPDAYIKASAPYNHHGRSKCHGRSGMVLSPCSRELGPPPPTVCEAEFEEIMNRNR
AISSSAISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEA
KSYSVGAGGSSSRKRHRSRERSPSRSRESSRRHRDLLHNEDRHEDYFQERNREHERHRDR
ERDRHH
Download sequence
Identical sequences F6XYP6
ENSMODP00000033409 XP_007497687.1.35504 XP_007497688.1.35504 XP_016279057.1.35504 XP_016279061.1.35504 ENSMODP00000033409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]