SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033725 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033725
Domain Number 1 Region: 470-662
Classification Level Classification E-value
Superfamily SET domain 4.06e-57
Family Histone lysine methyltransferases 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000033725
Domain Number - Region: 405-443
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00128
Family Myb/SANT domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033725   Gene: ENSMODG00000001852   Transcript: ENSMODT00000035308
Sequence length 678
Comment pep:novel chromosome:BROADO5:8:212989729:213048055:-1 gene:ENSMODG00000001852 transcript:ENSMODT00000035308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKILERTEILNQEW
KQRRIQPVHIMTSCSVTSDLDFPKQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLH
NIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALDEKQKDLEDNR
DDDKESHPPRKFPSDKIFEAISSMFPDKGTSEELKEKYKELTEQQLPGALPPECTPNIDG
PNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPHCYQ
HLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGT
ETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGT
YYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPAEDVDTPPRKKKRKHRLWAAHCRKI
QLKKGQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQR
GSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFN
LNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRY
SQADALKYVGIEREMEIP
Download sequence
Identical sequences F7AIG6
ENSMODP00000033725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]