SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033971 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033971
Domain Number 1 Region: 35-103
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.79e-16
Family Canonical RBD 0.008
Further Details:      
 
Domain Number 2 Region: 234-327
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000827
Family Tudor domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033971   Gene: ENSMODG00000017190   Transcript: ENSMODT00000035557
Sequence length 363
Comment pep:known_by_projection chromosome:BROADO5:2:188866990:188909512:1 gene:ENSMODG00000017190 transcript:ENSMODT00000035557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSSGEHRTFTKYPKKNGKSDQHKTLGHRKKESEVYVGNLPLDTKEEDILSLLKDFGPL
RVQKVQNGCKCFAFVDLASVENVHLAVKQLNGQMFHNRKLYLNSNNRIPKQNSDSTKGNT
ELPALENVPFEEKATGTLGEEEETTVTPVPASQTLRAPVSPNVTERPRTASYAVPMEMRG
SFLVFLLRDCFQDLSWLAIIRSIRGEVGLLVTDTLPQTPFFWAIHLTEETHVNMEKLFYA
LAEVEEQQPYLAEAEVQRGIRCLGECHLGDDDGGAWNRCWVLDRIGDWAVVLFIDFGCSA
TLPVHSLRSLDSDDFWAIPPLTQPFMLEKDILSSKQAVRQVLKGKITGCLSMESHILKFE
ETK
Download sequence
Identical sequences F6Z4A9
XP_007482059.1.35504 ENSMODP00000033971 ENSMODP00000033971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]