SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034042 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034042
Domain Number 1 Region: 447-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-64
Family Protein kinases, catalytic subunit 0.000000000202
Further Details:      
 
Domain Number 2 Region: 153-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.22e-24
Family Ras-binding domain, RBD 0.00038
Further Details:      
 
Domain Number 3 Region: 225-278
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000135
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034042   Gene: ENSMODG00000013637   Transcript: ENSMODT00000035628
Sequence length 767
Comment pep:known_by_projection chromosome:BROADO5:8:203028035:203242460:-1 gene:ENSMODG00000013637 transcript:ENSMODT00000035628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSGGGGGGGGAEQGPILFNGDMDPEAGAGSASSAEPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDTVTS
SSSSSLSVAPSSLAVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRRQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLGETTLTSGSSPSAPPSDSIGPPVLTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGLRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMESIHLSSVCERFIKVTNNYIFLHEDLTVKIGDFGLATV
KSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNIN
NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
Download sequence
Identical sequences F7FV05
ENSMODP00000034042 ENSMODP00000034042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]