SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034177 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034177
Domain Number 1 Region: 268-351
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-29
Family Canonical RBD 0.0013
Further Details:      
 
Domain Number 2 Region: 151-254
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-18
Family Canonical RBD 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034177   Gene: ENSMODG00000024448   Transcript: ENSMODT00000035763
Sequence length 446
Comment pep:known_by_projection chromosome:BROADO5:1:172163749:172169723:-1 gene:ENSMODG00000024448 transcript:ENSMODT00000035763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDDFDIVIEAMLEAPYKKEEQRKEVKKDSPSNTSTSTSTSTSTSSTSNSGGGGTSGSS
TSGETSKKKRSRSHSRSKDRKRSRSRDRDRHRRRNSRSRSRDRQRRHRSRSRDRRRSSKS
RSRDRRREERVRYRSPPLATGRRYGHSKSPHYREKSPVREPIDNLSPEERDARTVFCMQL
AARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGLTGQRLLG
VPIIVQASQAEKNRLAAMANNLQKGSGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIV
LMKDPDTGRSKGFGFLTFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPD
GGEELDLGTAGGRLQLMAKLAEGSGIQLPTTAAAAQAAALQLNGAVPLGALNPAALTALS
PALNLASQAIASQCFQLSSLFTPQTM
Download sequence
Identical sequences F7CF56
ENSMODP00000034177 ENSMODP00000034177 XP_007479865.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]