SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034552 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034552
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034552   Gene: ENSMODG00000024548   Transcript: ENSMODT00000036140
Sequence length 238
Comment pep:known_by_projection chromosome:BROADO5:3:358709152:358854206:1 gene:ENSMODG00000024548 transcript:ENSMODT00000036140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPNDFLAIFPWPKYKWSGHFRALSTSHRLGICSTLSYWLQ
Download sequence
Identical sequences F7F262
ENSMODP00000034552 ENSMODP00000034552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]