SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034649 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034649
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.84e-39
Family Canonical RBD 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034649   Gene: ENSMODG00000024570   Transcript: ENSMODT00000036237
Sequence length 356
Comment pep:known_by_projection chromosome:BROADO5:1:156262394:156441565:-1 gene:ENSMODG00000024570 transcript:ENSMODT00000036237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRRKRGREGHDPKEPEQLRKLFIGSLSFETMDDSLREHFKWGTLSDFAVMRDPQTKHSR
GFGFVTYSCVEEVDAAMCAQPHKVDGHVVEPKRSISREDSVKPGAHLTMKKIFVGGIKED
AEEYNLRDYFEKYGKIKTIEVMEDQQSGKKRGFAFVTFDDHDTVDKIFVKYHTINGHNCE
SKKALFKQEMQSSGSQRGCGGGSGNFMGQGGNFEGGGGNFDGRGGYGDGGGGSRGSYGGG
DGGYNGFGGDGGNYGGGPGYSSRGGYGGGGGPGYRNQGGEYGGGGGGDGYNEGGNFGGGN
YDDSGNYNGFGNYSGQKQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF
Download sequence
Identical sequences F7BTN0
ENSMODP00000034649 ENSMODP00000034649 13616.ENSMODP00000034649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]