SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034857 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034857
Domain Number 1 Region: 27-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.17e-33
Family Canonical RBD 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034857   Gene: ENSMODG00000024607   Transcript: ENSMODT00000036445
Sequence length 156
Comment pep:novel chromosome:BROADO5:3:333702137:333702607:-1 gene:ENSMODG00000024607 transcript:ENSMODT00000036445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLLIALQSDSYVELGWYRDQQFRGKMEDQEKLLKKSCTLCVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTHLDDRIIRTDWDAGFR
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKTVQNQ
Download sequence
Identical sequences F6PQN5
13616.ENSMODP00000034857 13616.ENSMODP00000034858 ENSMODP00000034857 ENSMODP00000034858 ENSMODP00000034857 ENSMODP00000034858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]