SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034885 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034885
Domain Number 1 Region: 472-657
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.32e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034885
Domain Number - Region: 364-430
Classification Level Classification E-value
Superfamily WWE domain 0.000106
Family WWE domain 0.014
Further Details:      
 
Domain Number - Region: 237-261
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0108
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034885   Gene: ENSMODG00000015744   Transcript: ENSMODT00000036473
Sequence length 665
Comment pep:known_by_projection chromosome:BROADO5:7:245186191:245246617:-1 gene:ENSMODG00000015744 transcript:ENSMODT00000036473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEAGTTCIVQPHCPPDEFPCQMRLTEKIAPVKTCFKKKQVQKRLSTGTLRTLRPILNT
LLESGSLDGVFMPMNSSGNGDSSLCQPVVKKALGMNSPCPPVGSGMSILLSGGSDVRNQI
PEADPSSEDTEQVVPSQDHGFSSETTSGTVPDPTGQPFQDPLLHTAASDVPVSPDCTEKA
MDCVPGLFQQDNYALQYNFSTSNKFNTGLFQGKSEEASLDLVFELLNQLQYHTHQENGIE
ICMDFLQGSCVYGSDCLKHHTVLPYHWQVKRTASQMWQSVTNDSQEHLERLFCNPDNDRV
RLKYSKQEWAFGCENCLITHTPTFNGLLQKALICPECQESHKPCHVAFFLFFLGFRGFFS
RLPLSVIRLIEETSFRGLREVRFSMLHHQYILNIKDNYQQSIFSRRIMKKRPLLRSCLVL
MPYLQTLGGMPLSPLPAAEAASSQVLCPSVVTSANFYPETWIAMDPSQDFIQVPVSKEDK
SYRTIYNLFHKTVPEIKYRILKILRVQNQFLWEKYKRKKEYMSKKANDISRIMNERHLFH
GTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFARKASYSHSFSKRSPKGVHFMFLAKVL
TGRYTVGNHNMRRPPPVNPDSITSDLYDSCVDNYFEPQIFVIFNDDQSYPYFVIQYEEVS
NTVTI
Download sequence
Identical sequences F6PPH2
13616.ENSMODP00000034885 ENSMODP00000034885 ENSMODP00000034885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]