SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035006 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000035006
Domain Number - Region: 79-113
Classification Level Classification E-value
Superfamily SET domain 0.000196
Family Viral histone H3 Lysine 27 Methyltransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035006   Gene: ENSMODG00000024658   Transcript: ENSMODT00000036594
Sequence length 127
Comment pep:novel chromosome:BROADO5:7:233055473:233055853:1 gene:ENSMODG00000024658 transcript:ENSMODT00000036594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGDISQSSNLFTGNECLYDTYPEIPLEEMPEVDGEVGALSLSIQEPASPATSCEEFTPKE
GSPYKAPIYIPDDIPIPPEFELRESNVPGAGLGIWTKRKIEVGEKFGPYIGEQCSDLKDP
SFGWEVR
Download sequence
Identical sequences F7CAM4
ENSMODP00000035006 ENSMODP00000035006 13616.ENSMODP00000035006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]