SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035055 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035055
Domain Number 1 Region: 1148-1197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000187
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 2 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000225
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 26-142
Classification Level Classification E-value
Superfamily SET domain 0.000000144
Family Viral histone H3 Lysine 27 Methyltransferase 0.058
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035055
Domain Number - Region: 1187-1232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000154
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 477-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000586
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 1468-1501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0213
Family Classic zinc finger, C2H2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035055   Gene: ENSMODG00000012362   Transcript: ENSMODT00000036642
Sequence length 1741
Comment pep:known_by_projection chromosome:BROADO5:4:380528674:380729088:-1 gene:ENSMODG00000012362 transcript:ENSMODT00000036642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQNTLESLEAPETLADVPEHVFRGLPEEVRLFPSAVDTTRIGVWAAKSILKGKKFGPFV
GDKKKRSQVKNNVYMWEVYYPNLGWMCVDATDPKKGNWLRYVNWARSGKEQNLFPLEINR
TIYYKTLKPIEPGEELLVWYNGEDNPEIAAAIEEERANTRSKRSSPKAKKGKKKSQEGKN
KANKTGDKAKLKKGDTVSASANMRDSEEGPKEEEEKPSASAVLSLEQTAVIQEMVNQDAL
PKLIIPPPVSEPQTLPQGTPEVVNCGSDDLEEEEGEEEDDEEEDEEEEGEEDANIPNESS
EREPEIECEGKQGTSEEPNITEENPDGSLEVMPAARIPKTKGDSNGDVFETFMFPCQHCE
RKFTTKQGLERHMHIHISTINHAFKCRYCGKAFGTQINRRRHERRHEAGPKRKPILTLPQ
PDDLVDSAVCGDDTNLKDESNASSLLQDCMIVDSERVSQEIAVSSVAEENGDLKELHPCK
YCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGFLLEEPQLPPEQTQPTQNVYIASTELE
EEGESDDVYIMDISSNISENLNYYIDGKIQSNSSTSNCDVIEMESNPTDLYGLNCLLTPV
TVEITQSIKTTQVHVAEDPAKDSSSSTNSESKKRRTTSPPFLPKIKAETDSEPITPSCSL
NLPLNISTTETVPYHKEKSVFLSSKLKQLLQTQDSNKLAPVISTTDTPKLGSSVSSSSSI
LPVSSSRFKRRTSSPPSSPQHSPALRDFGKQSESKAVWNDPAVSSKIPKLESHSSSPSWS
LSGREERDAVSPSCFDDYKMSKDWTASTTFGNVCNQQPLDLSSGIKQKSELTGKAQVPWE
SVLDLSVNKKSCGDMDIKEYKENNSVQPTCSGIKKKKPTTCMLQKVLLNEYNGIDLALEK
TPDGNRSPSPCKSLDPQPEPDLDPDSSLSAPVAHSSPCTSPLPLPQTSVSSGQLPPLLIP
TNPSSPPPCPPILTVATPPPPLLPTLPLPLPASSSSISPPPCPSPLSNTTTQSPLPILSP
TVSPSASPVPSVEPLNSVASPGPPILSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SFSSSSSSSSPSPPPLSVVSSVISSGDNLEAPLPISFKQEDTENEDQKPSDDPQTSDEQD
IIQETFNKNFICNVCESPFLSIKDLTKHLTIHAEEWPFKCEFCVQLFRDKTDLSEHRFLL
HGVGNIFVCSVCKKEFAFLCNLQQHQRDLHPDRECTHHEFESGTLRPQNFTDPTKAKADH
VQSLPAYPLEVSKEEEDEEEVNDSSEELYTTIKIMASGVKSKDPDVRLGLNQHYPSFKPP
PFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDK
KRYTPKKNPVPLKQTVQPKNGVVVIDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLSA
LKKKNQLVHKAILQKNKSAKQKADLKNSDSDSHSHICPYCDREFTYIGSLNKHAAYSCPK
KPISPSTKRSASHSSKKGGISSPANSEKSSNQRRRTADAEIKMQSMQTHLGKTRARSSGP
TPNPLPSPPFRAKQKVKFVPSVKSKKSSSSSLRNSSPVRMAKMSHTDGKKTKAVAKNHSA
HLSSKASRNLHVRVQKSKAALQSKPALVSKKKSDRFSVKSRERSGGPITRSLQLAASADL
TESKREESSTKQEIKDFSYSLRLAPRCPLSATPLARQCKKAQAQAQAQAPEAHLQGAFLK
E
Download sequence
Identical sequences F7B3D3
XP_007491812.1.35504 ENSMODP00000035055 ENSMODP00000035055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]