SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035244 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035244
Domain Number 1 Region: 427-861
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.45e-114
Family DNA polymerase I 0.0000003
Further Details:      
 
Domain Number 2 Region: 276-394
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000354
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035244   Gene: ENSMODG00000004074   Transcript: ENSMODT00000036832
Sequence length 873
Comment pep:known_by_projection chromosome:BROADO5:5:232281814:232742134:1 gene:ENSMODG00000004074 transcript:ENSMODT00000036832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENMENYEGNVGFDLSKMPLSNIAQRIMAAMHSFDLEENKNFRENEKSEFTKMFPHHNPVR
YLVKALLSPQLIQTSSIGNSFDLHYQPPKASSIISLQSTGILHSNQMSNIKDPNSSGSLP
LSSCVYTPLHFKPSHLQKNGNKKEYLLKENTNIEKKETKNLKRKHATASHMSEQAKNCFT
MEEFGIGIETKYKNSGETKSLENPVCDVRHLGPVEKRQLIEILKQATTLVVTMIYQDGPF
QLKHDEDLNSMVKGIIILIKSPLDTRNHPFCASTTDPPVMDGFSIDDRYIYIKVEHDTLW
RQEQEMSNQFARTMLFQILKCKHTVICFNAKEFVKTVLQVYGSYCHWKHVVDFVVLDPRI
AAWLLDPSDTISSFEDLVRKYFEESVTMKVNNTNGGSSHNMMSLCSDLRILYRITLNEFS
PTIQVCGLWQLFYTLELPLIPILAVMETHKFQVDKEEMKRTSKLLGCRLKELEQEAHVAA
GEQFLVTSNNQLREVLFDKLKLHLLCKSKTLPKTELQKHPSTSEAVLNALQDLHPLPKII
LEYRQIHKVKSTFVDGLLSCMRKGFIAPTWNQTGTVSGRLSAKKPNIQGISKHPIQITKH
QYEQGKEDEKTTVSPRTMFISSKGYTFLAADFSQIELRILAHLSCDPELLKLFQEPESLD
VFMSLTSQWKGIPLEQVTHVEREQTKRIVYSVVYGAGKERLAACLGVTSLQSSQFIESFL
QKYKKIHDFTQETIMQCHHKGYVTSIMGRRRPLPNINAKDYRLRTQAERQAVNFVVQGSA
ADLCKIAMIRIFTSIATSPKLTARLLAQIHDELLFEVEDSQIPEFAALVKETMESLQNIQ
AIGLCLKVPLKVNLATGRSWGCLRPFPEAAPGA
Download sequence
Identical sequences F7AF21
ENSMODP00000035244 ENSMODP00000035244 13616.ENSMODP00000035244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]