SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035284 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035284
Domain Number 1 Region: 214-306
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.88e-28
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000024
Further Details:      
 
Domain Number 2 Region: 142-243
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000109
Family Elongation factors 0.0011
Further Details:      
 
Domain Number 3 Region: 2-116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000531
Family G proteins 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035284   Gene: ENSMODG00000024711   Transcript: ENSMODT00000036871
Sequence length 325
Comment pep:novel chromosome:BROADO5:3:276542230:276543266:1 gene:ENSMODG00000024711 transcript:ENSMODT00000036871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITGTRQADAAVLVVTAGVGEFEAVISKTVQTCEHALLTSILGIPPTPPTTTTSQKRCEE
IVTETSTHMKKTSYDPDTVALGPFADWNIDNILELSSNPTWFKRWKVIQKEGNANGTALP
EALDCILPPCHPTVPTPPKLVVLTGISTRHGGPLLPRVSVTTKVKCVEMYHEALSEAMPG
DHIGFIVKNISVTDVCHGGNSKNELTMKSAGFVQVIILNHVGQIRTGCAPILGCHTAYIA
CKFAERNCSGKKLENSPKFLKSGDAAIVDMFPGKPVCVESFSDYPPLSYFAICDMRQTTA
VGVIKAADKKAAGAGKVTKSAQKAK
Download sequence
Identical sequences F6ZQF1
ENSMODP00000035284 ENSMODP00000035284 13616.ENSMODP00000035284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]