SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035382 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035382
Domain Number 1 Region: 176-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 87-154
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 529-578
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000552
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035382   Gene: ENSMODG00000019387   Transcript: ENSMODT00000036970
Sequence length 583
Comment pep:known_by_projection chromosome:BROADO5:1:115397810:115401856:1 gene:ENSMODG00000019387 transcript:ENSMODT00000036970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLFADLERNGSGGGGGGGSGGGGGGGGGGGGGGGGGGGGGETLDDQRALQIALDQLS
LLGLDNDETGSLYDNEPRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKT
PVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGTVPGPPNLPGQTT
IQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIE
AHIALRTGGIIELTDENDFHANGTDVGFDLHHGGGGPGPGSLWSKPTPSITPTPGRKPFS
SYRNDSSSSLGSASTDSYFGGGTGGSTSAAATPRLTDYSPPSPALSFAHNGNNNNGNGYV
YPGGEATPSPDCCAELPGFDPAPAPPPGAQLLWSQFERSPGGGPAAPVSSSCSSSSASSS
ASSSSVVFPGGGGASPNANLGLLVHRRLHPGVSCPRLSPPLHGVGGEHHLARRVRSDPGG
GGLGYPAYANGLGAHLPGLPPSDSSASSSSSSSSSSSSSSSSGLRRKGSRDCSICFESEV
IAALVPCGHNLFCMECANRICEKSEPECPVCHTAVTQAIRIFS
Download sequence
Identical sequences F7DXF2
ENSMODP00000035382 ENSMODP00000035382 XP_007479330.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]