SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035400 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035400
Domain Number 1 Region: 421-503
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.22e-24
Family Surp module (SWAP domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 285-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-21
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 3 Region: 561-697
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.00000654
Family RPR domain (SMART 00582 ) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035400   Gene: ENSMODG00000021242   Transcript: ENSMODT00000036987
Sequence length 1053
Comment pep:novel chromosome:BROADO5:7:216930196:217006850:-1 gene:ENSMODG00000021242 transcript:ENSMODT00000036987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGRRSTHSCCCRRGGAGRKMADKTPGGSQKSSSKVISSDTVHSSGSSDAHMDAAGPSDTD
MPSRTRPKSPRKHNYRTESTRESLCDSPHQNLSRPLLENKLKAFSIGKMSAAKRTLSKKE
QEELKKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKP
SSRFADQKNAPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDE
RHKTKGRLSRFEPPQSDSDGQRRSMDAPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNI
NPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGK
MIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPP
PKSKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRF
LFENQTPAHVYYRWKLYSILQANLSGDAPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSE
EQETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCI
TESLSILKTPLPKKEIILYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTI
QGHLQSENFKQRVMTCFRAWEDWAIYPETFLIRLQNIFLGLVNIIEEKETEEVPDDLDGA
PIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDTSEDSKKNEPIFKVA
PSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLY
SNPIKEEMTESKSSIKYSEMSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVE
HYRDKLLQRGSLWPYHLQTHNNLKNICETLSVLKDKKEKDECTPTRKERKRRHSTSPSPS
RSSSGRRAKSPSPKSERSERSERSHKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSR
RSRSRSPKKSGKKSRSQSRSPHRSHKKSKKSKH
Download sequence
Identical sequences F7ACV6
ENSMODP00000035400 ENSMODP00000035400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]