SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035555 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035555
Domain Number 1 Region: 128-393
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.31e-71
Family BC ATP-binding domain-like 0.00000199
Further Details:      
 
Domain Number 2 Region: 30-158
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.88e-49
Family BC N-terminal domain-like 0.0000394
Further Details:      
 
Domain Number 3 Region: 376-494
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.46e-39
Family BC C-terminal domain-like 0.00013
Further Details:      
 
Domain Number 4 Region: 640-695
Classification Level Classification E-value
Superfamily Single hybrid motif 0.0000000000144
Family Biotinyl/lipoyl-carrier proteins and domains 0.0013
Further Details:      
 
Domain Number 5 Region: 685-727
Classification Level Classification E-value
Superfamily UBA-like 0.0000000714
Family TAP-C domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035555   Gene: ENSMODG00000021288   Transcript: ENSMODT00000037142
Sequence length 939
Comment pep:known_by_projection chromosome:BROADO5:7:206190018:206322614:-1 gene:ENSMODG00000021288 transcript:ENSMODT00000037142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPLGAAALLVAERSPWWHVRGLLLPGRWIWKQRTLRHSSTGRNNITKVLIANRGEIAC
RVIQTARKMGVQSVAVYSEADRNSAHVDMADEAYFIGPAASQQSYLSMEKIIQVAKTSAS
QAIHPGYGFLSENTEFAELCKQERIIFIGPPSSAIRDMGIKSTSKAIMSAAGVPVIEGYH
GEDQSDQCLKEHARKIGYPIMIKAVRGGGGKGMRIARSEEEFQEQLESARREAKKSFNDD
AMLIEKFVDTPRHVEVQVFGDQHGNAVYLFERDCSVQRRHQKIIEEAPAPGIDLEVRRKL
GEAAVRAAKAVNYVGAGTVEFIMDPNHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRI
AAGEKIPLSQEEIRLNGHAFEARIYAEDPQNNFMPGAGPLVHLSTPPSGPSLRIETGVRQ
GDEVSVHYDPMIAKLVVWAADRQAALKKLRYSLHQYNIVGLNTNIDFLLTLSSHPEFEAG
NVHTDFIPQHHQDLFPPPSATAKEVLCQAALALLLQEKAVTDAFRVQTKDQFSPFASSSG
RRLNFSYTRDMTLKDGQNNVAIAVQYNRDGSYRMQVEDKTFEVFGDLCKEGDSTYLKCSV
NGIVSKPKLIILDNTIHLFSMEGSARIGIPVPKYLSVASSEGAQTSTLAPMTGTIEKIFV
KAGDRVKTGDTLMVMIAMKMENKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVA
TDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASI
SVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQF
TFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFS
TMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTRSTTV
Download sequence
Identical sequences F7CQH6
ENSMODP00000035555 ENSMODP00000035555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]