SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035609 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035609
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 5.87e-17
Family Tetratricopeptide repeat (TPR) 0.0049
Further Details:      
 
Domain Number 2 Region: 842-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000085
Family HkH motif-containing C2H2 finger 0.07
Further Details:      
 
Domain Number 3 Region: 761-794
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000612
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035609
Domain Number - Region: 898-925
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000251
Family CCCH zinc finger 0.0043
Further Details:      
 
Domain Number - Region: 622-653
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00848
Family CCCH zinc finger 0.0075
Further Details:      
 
Domain Number - Region: 497-525
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0844
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035609   Gene: ENSMODG00000004986   Transcript: ENSMODT00000037195
Sequence length 964
Comment pep:known_by_projection chromosome:BROADO5:6:109323113:109375106:1 gene:ENSMODG00000004986 transcript:ENSMODT00000037195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSEGRRNRQQDIKKGLQFIQSPLPYRGTQEQYEVFLWTLIRNLFNEGNDMYQECDWN
GSLSQYTEALNIADYARSEEIAISNEILEKLHVNRIACYSNMGLNDRVLEDCDKVLSLNL
NNCRALYRKAKALSDLGRYKEAYDAIAKCSLAVPQDECVIKLTQEIAQKLGFKIRKAYVR
AKLSNSIPEEVATKGSKNSIEDIELDLSDPKHEATPVTSLLPPELSNELASIPITPLTPV
LPLQMEKSSLPSAMLANGGKIPFTLPETYLDDGDIVLGDEIDELLDSAPEADETIMSASV
VRGSIPTSSVTSSIPFSAPLLGTCAGYVPASSFSEIYPQPLTSSLEDFCSSLNTFSMSDS
KRDLPTSTSREGALLNNNSSSILLMNGPASLFASESFLGISSQPRNDFGNIFNSGSPKVS
SSLAGRNPLEGSHELRQACQLCFVKSGPKLMDYTYHLTLDHKCKKDILIGRIKNVEDKSW
KKIRPRPTKTNYEGPYYICKDVAAEEECRYPGHCTFAYCQEEIDVWTLERKGAFSREALF
GGSGKINFTVFKLLQEHHGEFIFLCEKCFDHKPRIISRRNKDISSSCSHPVTKHEFEDNK
CLVHILRETTVKYSKIRAFHSQCQLDLCRHEVRYGCLREDECYYAHSLVELKVWIIQKET
GITHDAIAQESKQYWQNIEAKAHGAQVPGNQIKYGSLNLKIKFVCAPCLRNGQVIEPDKN
RKYCSAKARHSWDKDRRAMRVMSNERKKWMNIRPLPTKKQMPLQFDLCNHIASGKKCQYV
GNCSFAHSPEEKEVWTYMKENGIQDMEQFYDIWLKSQKPEKTDDVAGQSNKENGKQIHMP
TDYAEITVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSIC
DRYVAGTCTEGNTCKFAHGNAELHEWEERRDVLKMKLSKARKDHLIAPNDNDFGKYSFLF
KDLN
Download sequence
Identical sequences F7GB33
ENSMODP00000035609 XP_007498693.1.35504 XP_007498695.1.35504 XP_016279477.1.35504 XP_016279478.1.35504 XP_016279479.1.35504 XP_016279480.1.35504 XP_016279481.1.35504 ENSMODP00000035609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]