SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035735 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035735
Domain Number 1 Region: 44-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-22
Family Canonical RBD 0.0045
Further Details:      
 
Domain Number 2 Region: 239-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.66e-20
Family Canonical RBD 0.00011
Further Details:      
 
Domain Number 3 Region: 151-237
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-18
Family Canonical RBD 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035735   Gene: ENSMODG00000007003   Transcript: ENSMODT00000008855
Sequence length 592
Comment pep:known_by_projection chromosome:BROADO5:5:183719611:183883549:1 gene:ENSMODG00000007003 transcript:ENSMODT00000008855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEDSTTTMSNDSTNVSAAKVPEGIAGAPNEAALLALMERTGYSMIQENGQRKYGGPPP
GWEGLHPPRGCEVFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTH
KHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLD
VIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDED
VMETVKILYVRNLMIETTEETIKKSFGQFNPGCVERVKKIRDYAFVHFTSREDAVHAMNS
LNGTELEGSCLEVTLAKPVDKEQYTRYQKAAKGSATAEVTPQQPNYVYSCDPYTLAYYSY
PYNALIGPNRDYFVKAGSVRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQ
EKGYELVPNLELSAVNPVPIKPGTVAIPAIGAQYSMFQTAPAPKMLEDGKIHTMEHMINP
IAVQPDPASAAAAAAAAAAAAVMPAVSTPPPFQGRPITPVYTVAPNVQRIPAAGIYGASY
VPFAAPASATLATIQKSAAAAAAVYGGYGGYIPQPFPTATIQVPIHDVYQTY
Download sequence
Identical sequences F7BKF6
XP_001365552.1.35504 XP_007496594.1.35504 XP_007496595.1.35504 XP_007496596.1.35504 XP_007496597.1.35504 XP_007496598.1.35504 XP_007496599.1.35504 XP_007496600.1.35504 XP_007496601.1.35504 XP_016278758.1.35504 ENSMODP00000035735 ENSMODP00000035735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]