SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035882 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035882
Domain Number 1 Region: 213-255
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.44e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 256-302
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000102
Family LIM domain 0.00024
Further Details:      
 
Domain Number 3 Region: 136-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000402
Family LIM domain 0.00025
Further Details:      
 
Domain Number 4 Region: 101-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035882   Gene: ENSMODG00000000403   Transcript: ENSMODT00000037468
Sequence length 304
Comment pep:known_by_projection chromosome:BROADO5:2:105185538:105220761:-1 gene:ENSMODG00000000403 transcript:ENSMODT00000037468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSQAPTSPGPPWRVGPRQAGLPRGPLAPPPQCSGNMTSAPRWCCVQSFLMVGVAPGHA
FSGGEQKQSGGPERHPTNGPLERAPSSRSLEPAAAAAVRMPNWGGGKKCGVCQKTVYFAE
EVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLS
TDKGEREVMMSYKCQIIVIVLTTPRTPGHRPTTNPNASKFAQKIGGSESCPRCGQAVYAA
EKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGAL
VHSE
Download sequence
Identical sequences F7EBZ9
ENSMODP00000035883 ENSMODP00000035882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]