SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036056 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036056
Domain Number 1 Region: 69-157
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-18
Family Third domain of FERM 0.0093
Further Details:      
 
Domain Number 2 Region: 16-68
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000673
Family Second domain of FERM 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036056   Gene: ENSMODG00000020091   Transcript: ENSMODT00000025550
Sequence length 180
Comment pep:novel chromosome:BROADO5:3:206013946:206014923:-1 gene:ENSMODG00000020091 transcript:ENSMODT00000025550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHLNPDLQLIPEQVTTDINPECLVSPRYLKKYRNKARILEAHQNVAQMSLIEAKMRFIQ
AWQSFPEFGITHFIARFQGGKKEELIDFAYNRLIRMDASNGDAIKTWRFSNMKQWNVNWE
IKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences F6RZI3
ENSMODP00000036056 13616.ENSMODP00000036056 ENSMODP00000036056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]