SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036078 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036078
Domain Number 1 Region: 457-628
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.68e-21
Family Canonical RBD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036078   Gene: ENSMODG00000006673   Transcript: ENSMODT00000037667
Sequence length 716
Comment pep:known_by_projection chromosome:BROADO5:1:78946440:79168008:1 gene:ENSMODG00000006673 transcript:ENSMODT00000037667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDDLLMDKSKTQPQQQQRQQQQQQQQQQQQQQQEPNAAEASSTPLSSETPKPEDSSPVT
SLNPTAAAAAAASSTAPNSKEKMQMESPLLPGLSFHQPPQQEPAAAPGTSLSPSFGSTWS
TGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQAQHHQQQQPPPPP
PPAPQPQPPPPPPQQQQQPPPPQPQPPPPAQPQAQPQAQPQAQQQQRRSPVSPNQASYPQ
RNAAAYSHQPIMTSKPSSASASSSSSSWNNHQNAAWSTPSNPWGGLQAGRDPRRAVGVGV
GVGVGVPSPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQD
RNRPYDTFNLHSLENSLMDMIRTDHEPLKGRMGINFHHPGTDNIMALNTRSYGRRRGRSS
LFPFEDAFLEDSHGDQSLSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFR
RFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKD
KPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGID
TDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGT
RCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
Download sequence
Identical sequences F6RDG8
ENSMODP00000036078 ENSMODP00000036078 XP_007478873.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]