SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036305 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036305
Domain Number 1 Region: 28-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-44
Family GABARAP-like 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036305   Gene: ENSMODG00000024937   Transcript: ENSMODT00000037895
Sequence length 144
Comment pep:novel chromosome:BROADO5:4:112857750:112858181:-1 gene:ENSMODG00000024937 transcript:ENSMODT00000037895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGNQTQRINPLCCSQTPRGRSETLRSIMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIV
EKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQ
LYEDNHEEDYFLYVAYSDESVYGK
Download sequence
Identical sequences F6VUA1
ENSMODP00000036305 ENSMODP00000036305 13616.ENSMODP00000036305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]