SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036377 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036377
Domain Number 1 Region: 1-138
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-27
Family Motor proteins 0.0015
Further Details:      
 
Domain Number 2 Region: 1362-1452
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-21
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 3 Region: 1245-1361
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-20
Family Second domain of FERM 0.0026
Further Details:      
 
Domain Number 4 Region: 1145-1254
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000971
Family First domain of FERM 0.072
Further Details:      
 
Domain Number 5 Region: 543-611
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000289
Family Ubiquitin-related 0.088
Further Details:      
 
Domain Number 6 Region: 136-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000248
Family Motor proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036377   Gene: ENSMODG00000018664   Transcript: ENSMODT00000037966
Sequence length 1465
Comment pep:novel chromosome:BROADO5:4:110350458:110428452:-1 gene:ENSMODG00000018664 transcript:ENSMODT00000037966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETVKIRKAGYPIRYTFEDFFQRYKTLLPADAHVQLKDKPREGARRISETWLRKDKDWK
MGKTKIFLKEQQDTLLEVQRRQALYKNAVIIQKVIRGYKYRKEFLSQKRAAVTLQAMWRG
YTCRKNYKLIVLGFERLQAMFRGHQLSRQYKATRAQVIQLQALCRGYLIRRKVAEKRRAV
VVIQAHLRGMVARRSFRRRKREERRPALETEGESRKKQAAPPPRKRQSIYDPVSDTEMVE
QVFGFLPMIIGGQEGQAPQGFEDLESTPHKLTEVDLDAVPMSEEPEEDAEDPDEYTFPKF
AATYFQKAASHTHIRRPLRHPLLYLEEDEDFRIALLVWKIILRFMGEFSEPQLFAKNSSL
QGTAVTRQIQDTLGKKNSAHFLKAGEPEQNSTWRNKGTRDISSMKLKRSSRLTGQVARKL
SSGEEAFEEESPVTERPMTNLEKVHFIIRNAIQRPNIRDEIYCQICKQLSENYNKSSFAR
GWILLCLCLGCFPPSEKFMKYLLNFISKGPTGYRAFCSERLRRTYANGVRSEPPNSLELQ
AVKSKTRILFHVTLMNGESLTLTADSASSSREACQHIADKLHLKDLFGFSLYIAIYDKVT
RLSLHGKTLHYLHCVIWKPSLAKVFLFGAFKFYHESLESSTLSCSVFHTLISTNFSNEMN
FLLPIERLQEEDLVEVVAKHCYIEFGSSIQNSDIQKTLSTCIPGKVLKTKPQGQWVSLVT
AACAKASYIQNRSSPLLVKEQIVDMVCFQWPLLFSKFYEVTNISGPSLPKTELIVAINWK
GLCFIDKSEKKLLDLSFPEITGIATNSHVPSGQNFILSTLKAEEYVFISSESVAIAELVA
MFLEGLKKRSIYAMAMRDKKSTDDPTVLAHKKGDLLILIKSNGTVSSDKWIPAHNDRTDK
TGEVSVESIYIIPTVMKPTPEMMTLLAMSPEDRKLAIQNAQPEEPAEEPKEKPYTLEEYS
YEHFRLAEKETLNKAMFPKGRGKSQLWEHSREPLRQPLLKRVHANVDFRDIACQIFTDIL
FLLGQHLSQIPGDYPSKQARDPVELTDQIFLAPLEEATLRDEVYCQIMKQLTSNRNSYSL
ERGWQLLWLCTGLFPPSKTLLPHTQKFIETRRKKQQLAPDCSRRIQRVMRISPRKHPPHH
VEVEAIQQNITRICHKVYFPNDTNEVFEVGTNTKVQDLCQNISTHLQLNSWEGCSLFVKI
SDKVISQKETDFFFDSLRQVSDWIRKTKPTKEATTVTLTYHVYFMRKLWLNVFPGKDLNA
DVILHYHQELPKYLRGFHKCTREDAIQLAGLIYKVRFDNDRSQLATVSKILKDLVPENLI
RSMSSEEWKKNIFAAYSNSEKKTVDEAKVAFLKMIYRWPTFGSAFFEVKQSSEPAYPDII
LIAINKRGLQLIHPKTKEVLHTYPFSKISSWSSGSTYFHLVLGNLMKGSRLLCETSLGYK
MDDLLTSYVQLLMSAVSKQNSRTSD
Download sequence
Identical sequences F6UCG4
ENSMODP00000036377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]