SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036437 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036437
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 236-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000936
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 321-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000364
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 71-176
Classification Level Classification E-value
Superfamily SET domain 0.00000441
Family Viral histone H3 Lysine 27 Methyltransferase 0.063
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036437
Domain Number - Region: 205-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036437   Gene: ENSMODG00000007395   Transcript: ENSMODT00000038027
Sequence length 378
Comment pep:known_by_projection chromosome:BROADO5:3:166906989:166923567:1 gene:ENSMODG00000007395 transcript:ENSMODT00000038027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDFTEDDLRLVLYGAIRSQQLPARLHCAISGLRVPPDSSGAESVIQSLDKDSLKLPEGLC
ILKTMCGDIPQFGVFCSSLVPKGIRFGPFLGKVVNASEIKTYGDNSLMWEIFEDGHLSHF
IDGKGASGNWMSLVNCARFPEEQNLSAVQCQGQIFYESCKEILPNQELLVWYGDCYQQFL
GIPVSLKVLDKGKQPLEPPEESGESHKCERCGKVFAYKYYRDKHLKYTRCVDQGDRKFPC
NLCSRSFEKRDRLRIHILHVHEKHRPHKCSMCGKSFSQSSSLNKHMRVHSGERPYKCVYC
NKAFTASSILRTHIRQHSGEKPFKCKYCGKAFASHAAHDSHVRRSHNKEGGGCSCGICGK
IFSEQEKFRCHMKFHGVL
Download sequence
Identical sequences F6Y7L0
ENSMODP00000036437 ENSMODP00000036437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]