SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036476 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036476
Domain Number 1 Region: 396-562,860-1078,1133-1175
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-113
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 544-629
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-19
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 3 Region: 274-399
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000275
Family cAMP-binding domain 0.00083
Further Details:      
 
Domain Number 4 Region: 16-122
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000668
Family cAMP-binding domain 0.0022
Further Details:      
 
Domain Number 5 Region: 770-849
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000439
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036476   Gene: ENSMODG00000002092   Transcript: ENSMODT00000038066
Sequence length 1703
Comment pep:known_by_projection chromosome:BROADO5:5:115657676:115983714:-1 gene:ENSMODG00000002092 transcript:ENSMODT00000038066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYVDNSFRQAVMKNPAERSPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEA
NEVLYYPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVV
DYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPVGKPPLPRGYHTECTKS
QLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLP
ETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANM
TMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSF
GVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRE
LDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEW
FNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAA
KAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGSKAAEAGLKRGDQILEVNGQ
NFENIQLAKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASR
YSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQ
DDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFNTTPDLPDQVLRVFKADQQS
RYIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRI
QLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPT
EYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQLKRMKTIKHFIKIALHCR
ECKNFNSMFAIISGLNLAPVARLRTTWEKLPSKYEKLFQDLQDLFDPSRNMAKYRNVLNS
QNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVNMDPAL
MFRTRKKKWRSLGSLSQGSTNAAVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQ
YLSNLDLEMDEESLQTLSLQCEPATNTLPKNPGEKKSGKPDTSPVASRAGTQQKAQAQPP
PQQQPPPPTHKINPGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLER
HKKQAEDTISNASSQLSSPPTSPQGSPRKGGSGNQLRSYGSRQSDLTSSSSSLGSENSNK
NNNAPRTYGIGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSMPVSLHDERRQRHSV
SIVETNLGMGRMERRTLLDPDQYSLGSYAPVSETRGLYAGATVISSPSTEELSQDQGDRA
SLDAADSGRGSWTSCSSGSHDNIQTIPHQRSWETLPFGHAHFDSAGDGAALWASGSHMEP
VLFPDHSTKYNRQNQSRESLDQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAE
TSSITSVTTEETKPVPMPAHISVTSNTSAKGLIARKEGRYREPPPTPPGYVGIPITDFPD
GHSHPASRKPPDYNVALQRSRMVARTCETPGPSTLQQPHSHPTSRPVNKPQWHKPNESDP
RLASYQPQGFSTEEDEDEQVSAV
Download sequence
Identical sequences F6XP76
ENSMODP00000036476 ENSMODP00000036476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]