SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036498 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036498
Domain Number 1 Region: 214-328
Classification Level Classification E-value
Superfamily Acid proteases 1.13e-26
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Domain Number 2 Region: 5-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-16
Family Ubiquitin-related 0.0000808
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036498
Domain Number - Region: 129-169
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0288
Family XPC-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036498   Gene: ENSMODG00000024986   Transcript: ENSMODT00000038090
Sequence length 369
Comment pep:known_by_projection chromosome:BROADO5:3:159829609:159830715:1 gene:ENSMODG00000024986 transcript:ENSMODT00000038090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTVYCVRRDSTEMTFSLQVDRDFELHNFRVLCELESGIPADETHIVFAENSLEDNHRS
LASYGLKDGDVVILRQKANERAGSPGQFTGIDFSSIAVPGPSGTSRSPHQMQPPLSSGNV
VQVAESPAALRDMLLSNPHELAVLRERNPSLAEALFSGDLEEFTRVLIEQQEDQALRDEE
RFRLYVADPFDLEAQAKIEEAIRQQNIEENMSIAMEEAPESFGQVVMLYINCKVNGHPVK
AFVDTGAQMTIMSQACAIRCNILRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLAC
SFSIIEEQPMDMLLGLDMLKRHQCNIDLKKNVLVIGTTGTHTAFLPERELPECARLAYDP
GQDDLRMEE
Download sequence
Identical sequences F6XNN8
ENSMODP00000036498 ENSMODP00000036498 13616.ENSMODP00000036498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]