SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036499 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036499
Domain Number 1 Region: 779-989
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-48
Family DBL homology domain (DH-domain) 0.0000866
Further Details:      
 
Domain Number 2 Region: 1023-1219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-44
Family BAR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 245-305
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 4 Region: 1530-1590
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-17
Family SH3-domain 0.0000332
Further Details:      
 
Domain Number 5 Region: 1288-1365
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.0000083
Further Details:      
 
Domain Number 6 Region: 132-207
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-16
Family SH3-domain 0.001
Further Details:      
 
Domain Number 7 Region: 3-63
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000512
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 62-123
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000112
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036499   Gene: ENSMODG00000003273   Transcript: ENSMODT00000038091
Sequence length 1593
Comment pep:known_by_projection chromosome:BROADO5:1:70950152:71071141:1 gene:ENSMODG00000003273 transcript:ENSMODT00000038091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSMKHGEKLFVCISEFLSQDTDTLSLHRGDLVILDGLPTSSWQQGRNCWGAKGFFPSSC
IQELCLSSRSHQWDSQSTLLKIPEYSMGQARALMGLSAQLDEELNFREGDIITIIGIPEP
GWFEGELEGQRGIFPEGFVELLGPLRTVNDPVGSEDSAYFINGVLDVSQEERNRELEEDE
NELGAYGIALYKFQALEPKELDFEVGDRIQILRTLEDGWLEGKLRGKIGIFPYRFVKLFP
SPMMGETEDTSQENNQNNNLISSLSNLETSFVKHEERNKLHECNAKESTCTISEPSSLSP
NHPTLGCEEDKILQDKESELLRRPERGHEESLNKSFLDTDSTKPINGFFSQTPKLLQPQM
QNNLHFHTIEETRVTTDAAESHQRSKGCFDTLPSEAKDRHYPSISIRETCSLPRTLEGLV
SPLHSSSANSASGILKASQPSPKLKHGTDWTKDQQHRPREHCSNFSNMAKGMETEADLQA
KRCVTAALVLPQGESNTDLDSKLTEQLAQFERSLSRPKTEMDQKISRHFSIMDFSSEKDI
VRGAPMLPTQQETSERRKALRPPPPRPCAPASTLPHLLMNQKLKPESPSFSMRPSRPAPL
PPLPPQRMNLTSVKSHPSHHHCDSLEKENSSYVDKTLDSASQCSFLDRIQEMEQELEEFN
KTREELNLLLEEKQNEALRAGTLENLELCNDHIERLTMELQHLREMTLLSSHSASLESPS
VSVATDNPEQRMLEKRAKVVEELLQTEKDYVRDLEMCIEQIMVPLQQAQVQNMDFEALFG
NIQMVVNFSKQLLAALETTDTVGPVFLEHRDELEGVYKVYCQNHDEAIALLEIYEKEEKI
QKHLLEYLENLKSLYSEWGCANYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVP
LTAAVLAVKEINANINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLK
HLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACMKVLAAISMWDVC
MEKGNGDLEQFEKVHRYISDQLFTDFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLL
DFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFRHYAQGLFSNCIHGYAEA
HCDFVQRALKELQPLLALLKVADREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKRPF
ERKTTERQSSRKPLQGLPSYLLQSDELRAALLARYPPEKLYQAERNFNAAQDLDVSLLEG
DVVGVIKKKDPMGSPNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEPSS
SSPKFPRQNSSNASSVNPHHVATDLPSGPGQKLAQNPSLWQESGQESVSASSNAVVPEES
PSRCRRDKDSPSRTRSWNAVDLVDFPRDSDQQTPAVRASRHSVHPETVSQGMPRRHGQPR
QGGDLLKGCSRGVPPVEEQSEDQESLEAAGSQVYFAVYTFKARSPNELSVSANQRLRILE
FKDVTGNEEWWLAELNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences F6XNN0
XP_001366251.1.35504 XP_007478707.1.35504 ENSMODP00000036499 ENSMODP00000036499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]