SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036718 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036718
Domain Number 1 Region: 7-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.6e-20
Family Ubiquitin-related 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036718   Gene: ENSMODG00000025060   Transcript: ENSMODT00000038313
Sequence length 98
Comment pep:novel chromosome:BROADO5:8:66858535:66858828:1 gene:ENSMODG00000025060 transcript:ENSMODT00000038313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKLDAQMNVFLMFWHHKTTIFTDAKESSTVYEQKCIVGGIPNRPPDEQGLYKDDQLLDGS
KTLGECGFRSQTARAQAPAAVGLAFQADDAFETLHIES
Download sequence
Identical sequences F6SB62
13616.ENSMODP00000036718 ENSMODP00000036718 ENSMODP00000036718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]