SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036832 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036832
Domain Number 1 Region: 99-197
Classification Level Classification E-value
Superfamily SH2 domain 4.29e-29
Family SH2 domain 0.00001
Further Details:      
 
Domain Number 2 Region: 327-387
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-22
Family SH3-domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 42-115
Classification Level Classification E-value
Superfamily SH3-domain 8.74e-16
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036832   Gene: ENSMODG00000008992   Transcript: ENSMODT00000038427
Sequence length 389
Comment pep:known_by_projection chromosome:BROADO5:8:63733381:63763165:-1 gene:ENSMODG00000008992 transcript:ENSMODT00000038427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQENVFLTRNSPLPTLEFQEQSDGTLYGLVQAPQSPAAGQMPLSRQKGLIAALSLFPQRR
MEAVAKFDFNASGEDELSFHTGDVLKILSSQDEWFKAELGSQEGYVPKNFIDIQFPSWFH
EDISRHDAESLLMGKDVGSFIIRASQSSPGDFSISVRHEDDVQHFKVMRDAKGHYFLWTE
KFQSLNQLVNFYRTSSISKQKQIYLRDGGREEQDRWGGSLERRLQEGLHISGGVGEETRP
STNRKQSDHPPALQSHYQAQQPSPHQQQPIMSGMAQPRQDGKSSDHQRHRGLDRRGGSFD
VNEGRRMNPEMNAALMHRRHTDPEQLQMVGRIRWARALYDFEAEEEDELGFCTGEVVEVL
DSSNPSWWTGRLHSRLGLFPANYVTPLLR
Download sequence
Identical sequences F6V8G1
ENSMODP00000036832 ENSMODP00000011212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]