SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036858 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036858
Domain Number 1 Region: 146-240
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-22
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 2 Region: 320-412
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-22
Family Canonical RBD 0.00051
Further Details:      
 
Domain Number 3 Region: 244-330
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-17
Family Canonical RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036858   Gene: ENSMODG00000000609   Transcript: ENSMODT00000000746
Sequence length 561
Comment pep:novel chromosome:BROADO5:2:45892084:45893769:1 gene:ENSMODG00000000609 transcript:ENSMODT00000000746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEHVNGNGTEEPMDTSSAVTHSEHFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDER
AIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPD
EAKIKALLERTSYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVP
LFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV
ANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAA
QARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQ
FGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGG
YEDPYYGYEDFQVGARGRGGRGARGAAPSRVRRAAPPRGRAGYSQRGGPGSARGVRGARG
GAQQQRGRGGKGVEAGPDLLQ
Download sequence
Identical sequences F6V743
ENSMODP00000036858 13616.ENSMODP00000036858 ENSMODP00000036858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]