SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036903 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036903
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000206
Family Canonical RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036903   Gene: ENSMODG00000025105   Transcript: ENSMODT00000038499
Sequence length 176
Comment pep:novel chromosome:BROADO5:4:87226615:87227770:-1 gene:ENSMODG00000025105 transcript:ENSMODT00000038499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
SGSGNFGGGCGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSRDGYNGFGNDGSNFGG
AGSYNDFGNYNNQSSDFGPMKGGNFGGWSSDPYGGGQYFAQPRNQGGYGGSSSNSS
Download sequence
Identical sequences F6S8U9
ENSMODP00000036903 ENSMODP00000036903 13616.ENSMODP00000036903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]