SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037000 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037000
Domain Number 1 Region: 1997-2186,2240-2423,2459-2514
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-113
Family DNA polymerase I 0.000000853
Further Details:      
 
Domain Number 2 Region: 612-780
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.88e-41
Family Achaeal helicase C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 50-218,251-305,356-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-40
Family Tandem AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 4 Region: 1828-1992
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000133
Family DnaQ-like 3'-5' exonuclease 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037000
Domain Number - Region: 476-568
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0653
Family RecQ helicase DNA-binding domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037000   Gene: ENSMODG00000018252   Transcript: ENSMODT00000038597
Sequence length 2518
Comment pep:known_by_projection chromosome:BROADO5:4:85505081:85637770:-1 gene:ENSMODG00000018252 transcript:ENSMODT00000038597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSCKPIVVPENQIDKLLLASWGLPKAVLEKYHSLGVVQMFEWQAECLLLGQVLEGRNLVY
SAPTSAGKTLVAELLILKRVLEMRKKALFILPFISVAKEKKYYLQNLFQEVGLLVEGYMG
SCSPTVRFSALDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGDAHRGYLLELL
LTKVRYVTQRAAASPENLTSDFSKDIQIVGMSATLPNLDLVASWLNAELYHTDFRPVPLV
ESLKIGNSIYDSSMKLVREFQPMLQVKGDEDHIVSLCYEIIRDGYSVLIFCSKNWCEKLA
NIIAHEFCDLQRQAEGELQTPPELHPIALDHKGLAEVVDQLKRLPSGLDSVLQQTVPWGV
AFHHAGLTFEERDIIEGAFRQGLLRVLAATSTLSSGVNLPARRVIIRTPVFNGQCLDILT
YKQMAGRAGRKGVDTIGESILVCKKSEKSKGISLLQGSLKPVCSSLQRREGGETTASMIR
AILEIIVGGVANTPKDVQIYASCTFLAASLKMEKQKSLKGEKQKIRQEQHGAIEACVMWL
LENEFIQVSEANGETKEKVYHPTHLGSATLSSSLSPTEALDIFADLQRAMKGFVLENDLH
IVYLVTPLYEDWTAIDWYRFFCLWEKLPVSLKRVAELVGIEEGFLARSVKGRIVAKTEKQ
HRQMAIHKRFFTSLVLLDLISEVPLKDIIQKYGCSRGQIQSLQQSAATYAGMITVFSNRL
GWHNMEQLLSQFQKRLTFGVQRELCDLVRVSLLNAQRARALYAAGFVTVADLARGRAAEV
EAVLKSSLPFRSVRRAVDEEEEAAEERRSIRTIWVAGRKGLTEREAAILIVKEARMILQQ
ELAEMGVQWNPDSFLNSETHSASSSESEMEDLKSRYPAKHLFKRPRGSKRKTTIPFDKSL
TKNSPNTEQKAHMDKMPASTSNYIPQSGNQEHQLHVEMKNDEFVSSSRKSPFLGTSKDKV
VTTVNKRKSSTEEITKTFSNGNRKRAALNLSSEKLPKTPQFYNQSKLNHSEAGCSVKDSR
THRLGSQSITIVGTVKDLFPSDEKSTEFQMPESSAQNESLGTSVKYFKHQTPELLQPEES
CLKNQMTKDSDSEHLIVESQTENNSGQAPSVVGYNEVGKAKPNIEIMTNALLDNNNYMKN
QSVYGKHTNANPITNCPQKRPVTHAKVCVKEEVLLRRETHSHSTNTEKSVATSKCEGGES
KADENNPSHFQPPEDNISRPKVPNGIMFQVGVVDRDQDENDPKTSGVKKKVGVYAANETK
NNRSSDLGLGFRDFDDSFHLDTQTEKIIQQMAADAAKQEGAKDKNLVAMLTQKRLRRQNS
VSTSQNENNIYSSEGTAVGLGIVDIMKKTTESHAVEVLESPVLQSPMTSKENYFPFKGHE
NSVTDSQLNSFLQGYQTQDSVESAIPLGLQKRASVGQEGDCQLIFETSLNMSDSLLFDSF
SEDLEKDEIKEHKPDPQKGMPPSAITYDHSNSILCQQPHGSMDKAVSNLLPVDVNQDIQQ
EFVSFSDESIMFSEIDSLQMAEALDGPDLFLIPEQHVTAVTLNGLEQRNSGVINGNYPRS
RVDRIGQDENVQINKFTGENQDNPVAWSGASFDLSPGLQNILDGLESDKPSIVNMEPPTL
KEKSIGLKNNFEELKKDAKSSDFHGETSSPLLYKESNIISDHLESHAFFPLASTSVPPKH
GLSQVLGTSEKLGKDKMVLHTDECLTSDIEDQNFRQNGNIHMKNQSLTKDTDLSPKFSQD
MSQLTLVPCTEILTIIDVASDQTLFRTFIKEWQSKKRFSISLACEKASRPTCLKSTSIGG
KFKQVRSPELIPATDDGFPVKGHEDLLLVGLAVCWGERDAYYLSLQQEELHSEISASLAP
PSLDPNLTVNERLRQLQACLQHVSVKGRSVIIYNFIQNYKTLLLSCGISLAGNFEDPKVA
CWLLDPDSKEPTLHNIVTSFLSHELPLLEGIETGEGIQNLGLNTSDDHSGRYKAAIESIL
VFNTMTQLNSLLEKEKLHDVFCKVEMPSQYCLALLELNGIGFSTTECENQKHVMQAKLNA
LEAQAYELAGHSFSFTSPDDIAEVLFLELKLPPNGIQVKKKTLGSTRRMNTNGRTTKMGK
QFSTSKDILKKLKNLHPLPGLILEWRRITNAITKVVFPLQREKCMNPVLGMERLYPLSQT
HTATGRITFTEPNIQNVPRDFEIEMPTLVGESPSFQAQGRNTLNVFFSFYRESKSNINSA
YQMQLAARIKDNGKPFSVSMRHAFVPFPGGMILAADYSQLELRILAHLSRDRRLIEVLNG
GADVFKSIAAEWKMVDPEAVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIQENDAACYID
SFKSRYTGIQRFLRETVKNCSKDGFVQTILGRRRYLPGINDQNPYNKSHAERQAINTTVQ
GSAADIVKTATVNIQSRLEALPSVAQSHGHRESTLGGARTRSFPVSNAGFQRQFCPVKGA
FFILQLHDELLYEVAEEDVVQVAQIVKNEMENAVKLSVKLKVKVKMGPSWGELHDLDL
Download sequence
Identical sequences F7A6Q0
ENSMODP00000037000 13616.ENSMODP00000037000 ENSMODP00000037000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]