SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037050 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037050
Domain Number 1 Region: 66-153
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-36
Family SCAN domain 0.0000974
Further Details:      
 
Domain Number 2 Region: 623-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 183-245
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 664-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000142
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000532
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000593
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000806
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 760-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000762
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 10 Region: 542-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000151
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 719-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000139
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037050   Gene: ENSMODG00000027391   Transcript: ENSMODT00000038648
Sequence length 807
Comment pep:known_by_projection chromosome:BROADO5:6:51674453:51690526:1 gene:ENSMODG00000027391 transcript:ENSMODT00000038648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVDDQLKSEENLLLSEKVDLKSMISVLDEEMPALNNMVTISLRAQHEQDRDDSREQVNT
LRRAKFNSEASRQNFRCFLYPEKAGPREAVNQLWELCLQWLKPEIHTKEQILELLVLEQF
LTILPSEIRIWVKSQHPENIEEAVTLVEVVTLEEEALISQDSSFLRERSTVKAGISSVFP
VPRFQETITFQDVTPDFTQEEWAQLNPAQQDLCMDVLMENYRNLVFIGLELSVSKPDVIS
QMEHGKGPWLLKSEALRGISPYKDIETEAKESVPKWEYSVEESSQKTIIERTTKQSSLDP
KLGNENMKCHGSLVRQQGYQETDVKQVTITHEETVNKERSSEMNAFGGCFFLKSILITQQ
RVNSLYNCDTHGKTFKDNSKLNKYQRIYIGKYKLKCKEFGRAFSQISQLNLHHTNYSGEK
YHTYNECGKSYNKWANFTAHQRILSTEKPYKCNKCEQAFSQISQLNLHHANHSGEKCHKF
NECGKAYDKQTNFIEHQWIHSGEKSHKCNEYGKVFALKTNLSNPQKIHSVEKFCKCNDCG
KVFTMKTQLSRHQVSHLGEEFFKLNGYRKDISQKANLPQHQREKSYKCNDCERVFTQKAY
LTEYQRLHSVEKSYECKYCGKFFMQKANLTKHQRIHSVEKPHICNVCGKAFTLKTNLSRH
QKIHSVEKSYKCNECGQIFTKMTYLTEHQRIHSGEKSYKCIECGKTFSWRTHFTQHQCSG
AKLFKCKECGKSFAQQKRLTKHQKIHSEKSCKHNDYGEGFAQKTSHILHQRIHSGEKSYK
CIECGKAFSRKTQLIQHQLTYNGMKPH
Download sequence
Identical sequences F7GIG6
ENSMODP00000037050 XP_016279333.1.35504 XP_016279334.1.35504 ENSMODP00000037050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]