SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037069 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037069
Domain Number 1 Region: 86-175
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.39e-37
Family SCAN domain 0.0000872
Further Details:      
 
Domain Number 2 Region: 652-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-24
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 763-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 819-876
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 707-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 204-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 10 Region: 865-917
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000543
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037069   Gene: ENSMODG00000004771   Transcript: ENSMODT00000038668
Sequence length 936
Comment pep:novel chromosome:BROADO5:6:51640178:51656845:1 gene:ENSMODG00000004771 transcript:ENSMODT00000038668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAFFSFEQHGVHPSRMYAGVQPEAEGNWFTAGNSDLKSMVTIPDGEMLALNNMMTISLN
PQILAMHEQDRDDSREQVTTLGREKINSEASRKSFRCFPYPEKAGPREAVNQLWELCLQW
LRPEIHTKEQILELLVLEQFLTILPSEVRIWVKSQHPENIEEVVTLVEDLTQMLEEEVPS
SQDFPLLQERTTEKEGMSTVSPIARFQETITFQDVTPDFTWEEWAQLDTVQQDLCRDVLM
ENYRNLVFIGLSVSKPDVISQMEHGEVPWLLRSEVPRGICPYWDFGLEAKELIPMWETTV
KESSQETIMERTMGHSSWDSRLEEAFKCYGSLVRHQGHQETHLKQVTITHEETLSMEKGS
ENNEFGGCFSLSSILITQQRVPIVNQSINNHLLGAYYLPGTVLDTSDTNRINETIPSLYS
FDTHGKSFQDNSELNKCQKIYTGNYRLMYNEFGEAFSQISQFNLHHAGQSGEKPYKCNEC
GKAFTQRASLTQHHRIHSGEKPFKCNECGKAFTQRAHLTQHLFTHNGEKPFKCYQCGKAF
IQISQLNIHQRIHSGVRSYICNDCGKAFTQRTNLTQHQRIHSGEKPFKCNECGKAFTQRA
HLTQHMFTHSGSKPFKCTECGKAYSQLSQLNVHRRIHSGEKSYKCNECGKVFPMWAELTR
HLRTHSGEKPYKCNECGKAFTQRASLTQHHRIHSGEKPYKCNECGKAFTKRAHLTQHQFT
HSGEKPFKCNECGKAYGQFSQLNIHLRIHSGERSYKCNECGKAFTQRASLTQHQRIHSGE
KPYKCNECGKAFTQRAHLTQHQFTHNGEKHFKCNECGKAYSQISQLNIHRRIHSGEKSYK
CNECEKIFPKWADLNRHQRIHSGEKPYKCNECEKAFTQRAHLSRHLLTHSGEKPFKCNEC
GKAFTQRAYAIQHQRIHLGEKCLTPSRSLINVCELK
Download sequence
Identical sequences F7GI79
ENSMODP00000037069 XP_007498197.1.35504 ENSMODP00000037069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]