SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037509 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037509
Domain Number 1 Region: 291-334
Classification Level Classification E-value
Superfamily RING/U-box 0.0000393
Family RING finger domain, C3HC4 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037509
Domain Number - Region: 364-414
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000316
Family B-box zinc-binding domain 0.006
Further Details:      
 
Domain Number - Region: 440-488
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000343
Family B-box zinc-binding domain 0.0084
Further Details:      
 
Domain Number - Region: 858-1008
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00455
Family DnaQ-like 3'-5' exonuclease 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037509   Gene: ENSMODG00000009808   Transcript: ENSMODT00000039107
Sequence length 1126
Comment pep:known_by_projection chromosome:BROADO5:1:21660063:21709366:1 gene:ENSMODG00000009808 transcript:ENSMODT00000039107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGWMVPQSQLHLRRGAGSTVLEKERESKRLGSFPCIHTHPGGLPRPSPLPHSPAFQPGH
LGEALPRGTGLPPHQGPAASWSVTSSRSPAGDRQGKRRSQKKLHRPVFFLRAPSSPGGLC
LAESATDWGLTCRSPALEVPQGCTRTPSNPRVSRPGGGAGYLSQAWILGSEEGLGRSLPS
GIAFRSVIQVGPAQGGQMSQNEKESGSPAENRSRGALSTPAEAAPSTEPNQTPDPPPPKS
PSPPILVSVASTSTWSFRTDPVSSSQPETSASGSASSRARAMEAIGEEFCFLLCHVCKME
SKCPKLLSCLHTVCSKCLESHEPAGQCPICRDSHPQDSSLRSMDNLFFESLQRRISVYQH
IVQGGDEASCNRCREPADFWCFECEQLICTHCFEAHQWFVKHEARSVEELRKETAKDFLD
GTRKSNNLFCPNPTHRTPSLTSIYCRGCAKPICCTCALLDSSHKDQYCAISSEIQQRQEE
LSKITSDLKTQEQIFNDAHNKIKSAVSHLEEVKKETEELIRSQVQVMVEHIQAKEKELLE
TMENQYQENHQQMAGKLRHLNSMLQRIQNGEVLVEKLQHYASDQEVLEMHTFIREALEHL
SREKPLNLQAAVKVEEFVDCKAKLQALYTRVTKEKDPEVAKIETTDKKEEPMEPTTFTTE
ISDSDSQDEKKSQKPGHIGDNTTEPVSLPVHPSIRISPALKTCFPCSSLAPQPRPTVPSR
KRKSVHANKPTSRKVIKKEYGENGRHRTNKVFKQPGASTSGANQVVKLDPHHGPTNPAPS
SESRSTAESNNGSRTLVELGREDNPIVVISSSDESEETESSSDFGDSSDSEDIVECTGST
RAPLSHPTNNFRETIQEDRALVFFDLKVDSKTKKISQLAAVNGENNFRIIIQQEEALFSL
FSRGVAIEDGLQNFLCYLRSSSHPILAGYKLWSPNLTVFFKALETFSKKGEFHETVSGFL
DILPLIRDRVPGADSYKLKNLVKIYLSRNMNDNSALASVRAMRDLCKILHIYLGQSINRR
VLPFSNLDCFASLQPLVRVNVLTRAQAKLLALRNVSLTELQAAVHDDPEWGLRKYSRYLA
SRSSRSFPSLLGLRTYLEGLLSNPKPEGKQATGPHQGPPGKGPSHA
Download sequence
Identical sequences F7BED1
ENSMODP00000037509 ENSMODP00000037509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]