SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037638 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037638
Domain Number 1 Region: 4443-4774
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.19e-89
Family Hect, E3 ligase catalytic domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.5e-87
Family Regulator of chromosome condensation RCC1 0.0073
Further Details:      
 
Domain Number 3 Region: 2967-3259
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.59e-62
Family Regulator of chromosome condensation RCC1 0.0017
Further Details:      
 
Domain Number 4 Region: 3960-4036,4125-4306
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-60
Family Regulator of chromosome condensation RCC1 0.0062
Further Details:      
 
Domain Number 5 Region: 2735-2918
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-31
Family APC10-like 0.0065
Further Details:      
 
Domain Number 6 Region: 2560-2637
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.41e-30
Family CPH domain 0.0006
Further Details:      
 
Domain Number 7 Region: 3209-3332
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.39e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1866-1933
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.14e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1208-1294
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000275
Family Cytochrome b5 0.0073
Further Details:      
 
Domain Number 10 Region: 2462-2513
Classification Level Classification E-value
Superfamily UBA-like 0.0000656
Family UBA domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037638
Domain Number - Region: 3626-3716
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0171
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037638   Gene: ENSMODG00000000682   Transcript: ENSMODT00000039239
Sequence length 4820
Comment pep:known_by_projection chromosome:BROADO5:7:53688887:53895268:1 gene:ENSMODG00000000682 transcript:ENSMODT00000039239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEPFCLAAQARFDSKWLKTDLQLAFTRDGLCGLWNEMVKDGEILYPGTELIQNGELPP
RKDDTAECQSGTKKEDQSEKEKKDEEETPVPMYRAKSIVESWVWGKQPDVNELKECLYVL
VKEQQTLATQTATTTLSAVRLKQRLVILERYFIALNRTVLQENVKVKWKSNSIPLPTVDK
KSSRPVGKGVEGLARVGSRAALSFAFAFLRRAWRSGKDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATKFLRSVVTGDVHGTPSTKGAGNIPLQDQHLALAILLELAVQ
RGTLSQMLSAIMLLLQLWDNGTRETDNERSAQGTSAPLLPLLQRFQSIICNKDMPNSEDE
IQMLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVIMAHLDRLATPCMPPQCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGITQIACAEKRFLILSRNGRVYMQAYNS
DTLGPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVFSWGCGDGGRLGHGDTVPLEEPK
MISALSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDQTIPMLVTG
LKGLKVIDVSCGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSVALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVVDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRITKPEPTALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDVCPMTFEQLDLLLRQVSEGMDGTSDWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPECLGLGLGSVLLNSLKQTVVTLASNAGVLNTVQSAAQAVLQSGWSVLLP
TAEERARALSALLPSAVSGNDMNVSPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEANASTLHRSRTPLDKDLINTGIYESAGKQTLPLVQLIQQLLRNI
ASQTIAKLKDVARRISSCLDHEQCSPDRSASLDLLLRFQRLLVSKLYPGDNGGQITNSFS
PELLGVGSLLKKYTALLCTHIGDILPVATSIASTSYRHFAEVSRVVDGDLTGSVLLPELI
VSIVLLLSKSPGLMQEAGAIPLLAGLLEHLDRFNHLAPGKERDDNEDLAWPGIMGSFFTG
QNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGDDPV
VALEAALQFEDTRESMHAFCVGQYMEPDQEVITTPDLSSLSSPLIDPERNLGLLLGLHAS
YLAMSTPLSPVEVECAKWLKSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGNTTPNKSKLY
SHRLTLSDHSQPFLQAIADNNIQDHTVKDFLCQIERYCKQCHLTTPITFPPEHPVEEVGR
LLLCCLLKHEDLGHVALSLVHPVTLGVDQVKHRTVPKSVVDVCRVVYQAKCSLIKTHQEQ
GRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKLKLLSSLPRWRRIAQKIIRERRKKR
EPTDVEESKIGNEEGDLEEACILPHSPVSVDKRPVPVKSPKDKWQPLLSTVTGVHKYKWL
KQNVQGIYPQSALLSTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAMKN
FLLPSVQYAMFCGWQRLIPEGTNIGIVVSKPQENNCLKDVDLIPPFNRMLLEVTFGKLYA
WAIQNIRNVLLDANARFKELGIQPVPLQTITNENPAGPSLGTIPQARFLLVMLNMLTLQY
GANNLNLLLNSGMLALTQTTLRLIGPSSDNIEEDMNACARGASATVLEESRKETTPVQLP
VSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYR
MGKEGKYDLKLAEPPPAAQPTTEDSDTEDDSESEQMERNLHPTSMMLTSTVNLLQTLCLS
AGIHAEIMQNEATRTLCGLLRMLVESGTIDKTSSLPNKLVYKEQHRSWCTLGFIRSIALM
PQMCSTLSTSQWITLLMKIVEGHESFTAASLQRQILAVHLLQAVLPSWDKTERSRDMKFL
VEKLFGFLGSLLSTCSSDIPLLRESTLRRRKARPQASLTATHSSTLAEEIVALLRTLHSL
SQWNGLINKYINSQLNSITHIFAGKQSEGAVLDDYFPDSENPEVGGLMAVLAVIGGIDSR
LRLGGQVVHDEFGEGTVTRITPKGKITVQFCDMRTCRVCPLSQLKPLPVVAFNVNNLPFT
EPMLSVWAQLVNLAGSKLEKHRIKKSSNQGPTGQVDLDLLRCQQLKLYILKAGRALLSHQ
DKLRQILSQPAIQDNGVISTGILFSDDGAAASPDIGDMSPEGPQPPMILLQQLLTAATQP
SPVKAIFDKQELEAAALAVCQCLAVESTHPSTPVFEECSSSEATTPVTVQHIRPVKVKKR
KQSPIPALPIVVQLMEMGFPRKNIEFALKSLTGSASGLPGVEALVGWLLDHPDVQITDLS
DADTVSDEYSDDEIVEDVEDAEASYPSSAVVTESQTYKKRADFLSNDDYAVYVRENIQVG
MMVRCCRTYEEVCEGDIGKVIKLDRDGLHDLNVQCDWQQKGSTYWVRYIHVELIGFPPQS
SPSHIKIGDKVRVKTSVTTPKYKWGSVTHRSVGVVKAFSANGKDVIVDFPQQSHWTGLLS
EMELVPSVHPGVTCDGCQMFPINGPRFKCRNCDDFDFCETCFKTRKHNTRHTFGRINEPV
GQSPVFCGRSGKQLKRCHSSQPGMLLDNWSRIVKNLNVSSSVNQASRLIDGSEPCWQSSG
SQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPADT
TVPLLTDCTEYHRYIEVAIKQCRSSGIDCKIHGLIILGRIRAEDEDLAAVPFLASDNEEE
EDDKANTGSLIRKKSSGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALN
VVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSNYVVKKVAVH
SGGRHAMALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAA
ITSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGL
VFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGD
YFRLGHGTDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDTGQVYAWGDNDHGQQGNGT
TTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLG
VPSDADSSAASNKISGANSSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAV
VGALMPASMIAPVECPSSSSPAPPSDVSSVGSPMNGEESVMAVDVEDRLSPNPWQDRRGE
VVPSEDAVTPSAVTPSASSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKVSGPEP
QYLDEFTSLLVPDDTRVMVDLLKLSVSNRAGEKGKDVLSAVLSGMGTAYPQVADMLLELC
VTELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERR
HDPLTIMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMP
AAGPKDLLSDRCILSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAAGHR
MWALQRLRKLLTTEFGQSININRILGDNDGETRAMSFTGSALAALVKGLPEALQRQFEYE
DPIVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRT
PLPCLFLDEVAKKIRELMADNEILDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGS
GTIYGWGHNHRGQLGGIEGAKVKVPTPCEALAALRPIQLIGGEQTLFAVTADGKKFVSGF
PSHSLTFLLSVSHRIPISTHCCVLSASLVIISNHIPFGPCDQAVVFLLCFLLGFGELGIG
DPHSEHVQICDIQCFTKGKKCHNGRTRSISSSNDFKGFLFHKVEALQGYRVIDIACGSGD
AQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTK
SGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWG
DNDEGQLGDGTTNAIQRPRLVAALQGKKINRVACGSAHTLAWSTSKPANAGKLPTQVPME
YNHLQEIPIISLRNRLLLLHHISELFCPCIPMFDLEGRLDETGHGPSVGFDTLRGILISQ
GKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSF
SPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEMCEELQNGLTPLLIVTPNGRDESGAN
RDCFLLNPAAKSSLHTNMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMNLTIADLSE
VDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKYTHITLDNRAEYVRLA
INYRLHEFDEQVSAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGI
EPTASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDH
FLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDS
DNEDADSFASDSTQDYLTGH
Download sequence
Identical sequences F7EP78
13616.ENSMODP00000037638 ENSMODP00000037638 ENSMODP00000037638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]